KEGG   Mus musculus (mouse): 100503733Help
Entry
100503733         CDS       T01002                                 

Definition
(RefSeq) PRAME family member 8-like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FTH LRR_4
Motif
Other DBs
NCBI-GeneID: 100503733
NCBI-ProteinID: XP_003085695
Ensembl: ENSMUSG00000094741
UniProt: Q8C9W1
Position
5
AA seq 407 aa AA seqDB search
MTVQTPSTLQNLALQALLRDEALALFCLEEVPFLLFPALFKEAFAGRLKKLMKAIVAAWT
FPCLPVGALMKSPNLETLQAVLDGIDMQLTRESHPRGKLQVLDLRNVHHAFWDIWAGAED
GSCSSESLNEKPTVVKVLRRYARRKQLKVVADLCLRPRRDETQAYFLKWAQQRKDSLHLC
CINMKIWAMPVDFVLEILNVFHPEHIEEFELNTEWNVFNLARFAPCLGQMRNLRKLLLAP
LYKNVFKIANRTGDREDKCVKEFVSIFSKFNCLQHLSMQGVHFLTDHMSQVFRCLMTPLE
SLSITHYQISQSDLDSFSCCQSLFQLKHLEMKGMVLQVLDVMPLRGLLEKVAKTLETLNL
QGCKLKDSQLNALLPSFIRCSQLTKINLYNNDFSMPILKDLLQQTAN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcagactccgtccactctccagaatctggcattgcaggctctgctgagagat
gaggctttggccttgttctgtctggaggaggtgccttttctgctcttcccagctctgttc
aaggaggcctttgctggcagacttaagaagctcatgaaggcaatcgtggcagcctggact
tttccctgtctccctgtgggggctttgatgaagtcacctaacttggagaccttgcaggct
gtgctagatggaatagacatgcaactgacaagagaatctcaccccaggggaaaacttcag
gttctggacctgaggaatgtgcaccatgccttctgggacatatgggctggtgcagaggat
ggtagctgttcttcagagtccttgaatgagaagcctacagtagtgaaggtccttcgcaga
tatgcacggaggaagcagctgaaagtggtagcagacctgtgcctcaggccccgccgtgat
gaaacacaagcatacttcttgaagtgggcccagcagagaaaggactccctacatttgtgc
tgtataaacatgaagatctgggctatgcccgtggactttgtcttagagattttgaatgtc
tttcatccagagcacatcgaggaattcgaactgaacactgagtggaatgtgtttaatctg
gcccgttttgctccctgcttagggcagatgagaaatcttcgcaaacttctcctggcaccc
ctctataagaatgtcttcaagattgccaataggacaggagacagagaagataagtgtgtc
aaggagttcgtttctatcttctccaaattcaattgtctccagcatctctccatgcaaggt
gtccactttctcacagaccacatgagtcaggtcttcaggtgcttgatgacacccttggag
tccctctccatcactcactaccaaatttcacagtcagacttggattccttctcttgctgt
cagagtctctttcagctaaaacatctggagatgaaaggcatggtcttacaggttttggat
gtgatgcctctgagaggtctcttagagaaagtggcaaaaactcttgagactctgaatttg
cagggatgtaagctgaaggactctcagctcaatgcactcctaccttccttcatacgatgc
tctcagctcaccaagatcaacttgtacaacaatgacttctccatgcccatcctgaaggac
cttttacagcaaacagccaactga

DBGET integrated database retrieval system