KEGG   Mus musculus (mouse): 100503970
Entry
100503970         CDS       T01002                                 

Symbol
CRS4C
Name
(RefSeq) cDNA sequence AY761185
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100503970 (CRS4C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100503970 (CRS4C)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100503970 (CRS4C)
SSDB
Motif
Pfam: Defensin_propep
Other DBs
NCBI-GeneID: 100503970
NCBI-ProteinID: NP_001012658
MGI: 3630303
Ensembl: ENSMUSG00000079120
Vega: OTTMUSG00000018344
UniProt: Q5ERI8
Position
8; 8 A2
AA seq 94 aa
MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPERYVLQVSGLG
KPPQCPKCPVCSKCPQCPQCPQCPGCPRCNCMTK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagacactcgttctcctctctgcccttgtcctgctggccttctatgtccaggctgat
tctacccaagagactgatgaagagactaaaactgatgatcagccaggggaagaggatcag
ggtgtgtctgtctcctttgaagacccagaacgctatgttcttcaagtttcaggcctagga
aagcctccccagtgcccgaagtgcccagtgtgctcaaagtgcccacagtgcccacagtgc
ccacagtgcccggggtgcccgaggtgcaattgcatgacaaaatga

DBGET integrated database retrieval system