KEGG   Mus musculus (mouse): 100504663
Entry
100504663         CDS       T01002                                 

Gene name
Atg14, 4832427M01, Atg14L, Ba, D14Ertd114, D14Ertd114e, D14Ertd436, D14Ertd436e
Definition
(RefSeq) autophagy related 14
  KO
K17889  beclin 1-associated autophagy-related key regulator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100504663 (Atg14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100504663 (Atg14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100504663 (Atg14)
   05014 Amyotrophic lateral sclerosis
    100504663 (Atg14)
   05016 Huntington disease
    100504663 (Atg14)
   05017 Spinocerebellar ataxia
    100504663 (Atg14)
   05022 Pathways of neurodegeneration - multiple diseases
    100504663 (Atg14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    100504663 (Atg14)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    100504663 (Atg14)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100504663 (Atg14)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100504663 (Atg14)
SSDB
Motif
Pfam: Atg14 Borrelia_P83 MnmE_helical
Other DBs
NCBI-GeneID: 100504663
NCBI-ProteinID: NP_766187
MGI: 1261775
Ensembl: ENSMUSG00000037526
UniProt: Q8CDJ3
Position
14 C1; 14 24.6 cM
AA seq 492 aa
MASPSGKGSWTPEAPGFGPRALARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQ
SGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRI
EQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKT
IDLKSHYERLARLRRSHILELTSIIFPIDEVKTSGRDPADVSSETDSAMTSSMVSKLAEA
RRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPA
YTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQKLTRAVRKLNANILYLCS
SQHVNLDQLQPLHTLRNLMHLVSPRSEHLGRSGPFEVRADLEESMEFVDPGVAGESDASG
DERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQVSPPIASSSAGGMISSAAAS
VTSWFKAYTGHR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgtctcccagtgggaagggatcttggacgcccgaggctcctggttttgggccgcgg
gcgctagcacgggacctggtggactcggtggacgacgccgagggcctttacgtggctgtt
gagcggtgtcctctgtgcaacaccactcgccggcggttgacttgcgccaagtgcgtccag
agcggtgatttcgtctatttcgacggccgcgaccgggagaggtttattgacaagaaggaa
agactaagccaacttaagaacaagcaagaagaatttcagaaagaagtactaaaagctatg
gaaggaaagcggcttacagatcagttgagatggaaaataatgtcatgcaagatgaggatt
gaacagctgaagcaaacaatatgtaaaggaaatgaggaaatgaagaaaaattctgaaggt
ctcctcaagaacaaggaaaagaaccagaagctttacagccgagcacagcggcaccaagag
aaaaaggagaagattcagcggcacaaccgcaagcttggggacctggtggagaagaagacc
attgacttgaagagtcactatgagcggttggcgcggcttcgaaggtcacacatcctagag
ctcacctccatcatattcccaatcgacgaagtgaagacttctgggagagaccctgcagac
gtgtcttcagagactgacagtgccatgacctcaagcatggtgagcaagcttgctgaggcc
cggaggacaacttacctctctggaagatgggtctgtgatgaccacaatggtgacaccagc
attagcatcacaggcccgtggattagcctaccaaacaacggggactactctgcttactac
aattgggtagaagagaagaaaacaacccaaggacctgacatggagcataacaaccccgcc
tacactatcagcgccgcgctgggctacgccacgcagctcgtcaacattgtgtctcacata
cttgacatcaatcttcccaaaaagctgtgcaacagcgagttctgtggcgaaaacctcagc
aagcagaaactgacacgcgcagtgaggaaactgaacgcaaacatcctttacctttgttct
tctcagcatgtaaatctggatcagttgcaaccactgcacacactcaggaacctgatgcac
ttggtcagcccgcgctctgagcacctaggcaggtcaggaccctttgaagttcgagcagac
ctcgaggagtccatggaatttgtggaccctggagttgctggagaatcagacgcgagtgga
gatgagcgtgtaagcgatgaggagactgacctgggcacagactgggagaacctgccaagc
ccccgattctgtgacatcccttcccagccggtggaagtgtcccagagccagagcacccag
gtgtccccacccattgccagcagcagcgctggtgggatgatctcctccgctgcggcctcg
gtgacctcttggttcaaagcttacactggacaccgctaa

DBGET integrated database retrieval system