KEGG   Mus musculus (mouse): 100505096
Entry
100505096         CDS       T01002                                 

Gene name
Defa33, Gm21002
Definition
(RefSeq) defensin, alpha, 33
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100505096 (Defa33)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100505096 (Defa33)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100505096 (Defa33)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_beta
Other DBs
NCBI-GeneID: 100505096
NCBI-ProteinID: NP_001257484
MGI: 5434357
Ensembl: ENSMUSG00000094362
Vega: OTTMUSG00000062185
UniProt: Q8C1N9
Position
8 A2; 8
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQAGEEDQAVSVSFGDPEGSALHEKSSR
DLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaggagactaatactgaggagcaggcaggggaggaggaccag
gctgtgtctgtctcctttggagacccagaaggatctgctcttcatgaaaaatcgtcgaga
gatctgatatgctattgtagaaaaggaggctgcaatagaggagaacaagtttatgggacc
tgctcaggacgacttttgttctgctgccgccgccgccaccgccactga

DBGET integrated database retrieval system