KEGG   Mus musculus (mouse): 100529082
Entry
100529082         CDS       T01002                                 

Gene name
Gm11127, H2-K1
Definition
(RefSeq) predicted gene 11127
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100529082 (Gm11127)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100529082 (Gm11127)
   04145 Phagosome
    100529082 (Gm11127)
  09143 Cell growth and death
   04218 Cellular senescence
    100529082 (Gm11127)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100529082 (Gm11127)
   04612 Antigen processing and presentation
    100529082 (Gm11127)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100529082 (Gm11127)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100529082 (Gm11127)
   05170 Human immunodeficiency virus 1 infection
    100529082 (Gm11127)
   05168 Herpes simplex virus 1 infection
    100529082 (Gm11127)
   05163 Human cytomegalovirus infection
    100529082 (Gm11127)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100529082 (Gm11127)
   05169 Epstein-Barr virus infection
    100529082 (Gm11127)
   05165 Human papillomavirus infection
    100529082 (Gm11127)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100529082 (Gm11127)
   05330 Allograft rejection
    100529082 (Gm11127)
   05332 Graft-versus-host disease
    100529082 (Gm11127)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100529082 (Gm11127)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100529082 (Gm11127)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    100529082 (Gm11127)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    100529082 (Gm11127)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100529082 (Gm11127)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  100529082 (Gm11127)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 Phage_holin_3_6
Other DBs
NCBI-GeneID: 100529082
NCBI-ProteinID: NP_001186896
MGI: 3779381
Ensembl: ENSMUSG00000079492
Vega: OTTMUSG00000037503
UniProt: A7VMS2
Position
17 18.88 cM; 17 B1
AA seq 374 aa
MGTLTSCPLLLLLLATALAPTQAGKSSHSLRYFATAISRPGFGEPRFTAVGYVDDTQFMR
FDSDSENPRAEPCKPWVEQMEPEYWEQETRKFKEHTQNFRTCLYNLLHLYNQSQDGPHTI
QDMHGCYVGPDGQFLHGHYQHAYDGHDYITLNEDLSSWTAADAVAQITQHKWEEAGVAEE
YKAYLEGTCVETLHRLLEEAQQHSDPPNTHVTRHPRPEGDVTLRCWALGFYPADITLTWQ
LNGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHEGLPEPLTLRWEPLP
STDSNMVIIAALVVFGAVIIIGAVVAFMMKRRNTGGKGGVYCWEPRPHSPLQDGADSCVL
SGKQIICACAKGIL
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggggacccttacgagttgccctctacttctcctgcttctggcgaccgccctggccccg
acccaagcgggcaagagctcacactcgctgcggtatttcgccactgccatatccaggcca
ggcttcggggagcctcggttcaccgccgtgggttacgtggacgacacacagttcatgcgc
ttcgacagcgactctgagaatcccagggccgagccatgcaagccatgggtggaacagatg
gagcccgaatattgggagcaggagacgcggaaattcaaggagcacacccagaatttccga
acttgcctttacaacctactccacctgtataaccagagtcaggacggtccccacacaatc
caggatatgcacggatgctacgtgggaccagatggtcagttcctacacgggcactatcaa
catgcctatgatggccacgattacatcaccctgaacgaggacctgagctcctggaccgca
gcagatgcagtggctcagatcactcaacacaaatgggaggaggctggagtggcagaggaa
tacaaggcctacctagagggcacatgcgtggagacactccacagattgttggaggaagct
cagcaacactcagaccccccaaatacacatgtgacccgtcaccccagacctgaaggtgat
gtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcag
ttgaatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggat
ggaaccttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaattacaca
tgccatgtgcaccatgaggggctgcctgagccactcaccctgagatgggagcctcttcca
tccaccgactctaacatggtaatcattgctgctctggttgtctttggagctgtgatcatc
attggagctgtggtggcttttatgatgaagaggagaaacacaggtggaaaaggaggggtc
tattgttgggagccgcgcccacattcgccgttacaagatggcgctgacagctgtgttcta
agtggtaaacaaataatctgcgcatgtgccaagggtatcttatga

KEGG   Mus musculus (mouse): 110557
Entry
110557            CDS       T01002                                 

Gene name
H2-Q6, 0610037M15Rik, H-2Q6, H2-K1, Qa, Qa-, Qa-6, Qa6
Definition
(RefSeq) histocompatibility 2, Q region locus 6
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110557 (H2-Q6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110557 (H2-Q6)
   04145 Phagosome
    110557 (H2-Q6)
  09143 Cell growth and death
   04218 Cellular senescence
    110557 (H2-Q6)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110557 (H2-Q6)
   04612 Antigen processing and presentation
    110557 (H2-Q6)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110557 (H2-Q6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110557 (H2-Q6)
   05170 Human immunodeficiency virus 1 infection
    110557 (H2-Q6)
   05168 Herpes simplex virus 1 infection
    110557 (H2-Q6)
   05163 Human cytomegalovirus infection
    110557 (H2-Q6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110557 (H2-Q6)
   05169 Epstein-Barr virus infection
    110557 (H2-Q6)
   05165 Human papillomavirus infection
    110557 (H2-Q6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110557 (H2-Q6)
   05330 Allograft rejection
    110557 (H2-Q6)
   05332 Graft-versus-host disease
    110557 (H2-Q6)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110557 (H2-Q6)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110557 (H2-Q6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110557 (H2-Q6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    110557 (H2-Q6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   110557 (H2-Q6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  110557 (H2-Q6)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 110557
NCBI-ProteinID: NP_001355670
MGI: 95935
Ensembl: ENSMUSG00000073409
Vega: OTTMUSG00000037190
Position
17 B1; 17 18.66 cM
AA seq 326 aa
MALTTLLLLVAAALTLIETRAGPHSLRYFHTAVSWPGLVEPRFIIVGYVDNKQFVRFDSD
AENPRMEPRARWMEQEGPEYWERETQKAKGHEESFRVSLRTAQRYYNQSKGGSHTLQWMY
GCDVGSDERLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITLHKWEQAGIAERDRAY
LEGACVQSLRRYLQLRKETLLCTDPPKAHVTHHPRSYGAVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVNHEGLPEPLTLRWEPPPS
TVSNMANVAILVVLVAWPSLELWWIL
NT seq 981 nt   +upstreamnt  +downstreamnt
atggctctaacaacgctgctcttgctggtggcggccgccctgaccctgatcgagacccgc
gcgggcccacactcgctgcggtatttccacactgctgtgtcctggcccggcctcgtggag
ccccggttcattatcgtcggctacgtggacaacaagcagttcgtgcgcttcgacagcgac
gcggaaaatccgaggatggagccgcgggcgcggtggatggagcaggaggggccggagtat
tgggagcgggagacacagaaagccaagggccatgaggagagtttccgagtgagcctgagg
accgcacagagatactacaaccagagcaagggcggctctcacacactccagtggatgtat
ggctgtgacgtggggtccgacgagcgcctcctccgcgggtacctgcagttcgcctatgaa
ggccgcgattacatcgccctgaacgaagacctgaaaacctggacggcggcggacatggct
gcacagatcaccctacacaagtgggagcaggctggtattgcagagagagaccgggcctac
ctggagggcgcttgcgtgcagtcgctccgcagatacctgcagctccggaaggagacgctg
ctgtgcacagatcccccaaaggcacatgtgacccatcaccccaggtcttatggtgctgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacttggcagttg
aatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgaaccatgaggggctgcctgagcctctcaccctgagatgggagcctcctccatcc
actgtctccaacatggcgaacgtagctattctggttgtccttgtagcttggccatcattg
gagctgtggtggattttgtga

KEGG   Mus musculus (mouse): 110558
Entry
110558            CDS       T01002                                 

Gene name
H2-Q9, H-2Q9, Pe, Ped, Qa, Qa-, Qa-2, Qa-9, Qa9
Definition
(RefSeq) histocompatibility 2, Q region locus 9
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110558 (H2-Q9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110558 (H2-Q9)
   04145 Phagosome
    110558 (H2-Q9)
  09143 Cell growth and death
   04218 Cellular senescence
    110558 (H2-Q9)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110558 (H2-Q9)
   04612 Antigen processing and presentation
    110558 (H2-Q9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110558 (H2-Q9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110558 (H2-Q9)
   05170 Human immunodeficiency virus 1 infection
    110558 (H2-Q9)
   05168 Herpes simplex virus 1 infection
    110558 (H2-Q9)
   05163 Human cytomegalovirus infection
    110558 (H2-Q9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110558 (H2-Q9)
   05169 Epstein-Barr virus infection
    110558 (H2-Q9)
   05165 Human papillomavirus infection
    110558 (H2-Q9)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110558 (H2-Q9)
   05330 Allograft rejection
    110558 (H2-Q9)
   05332 Graft-versus-host disease
    110558 (H2-Q9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110558 (H2-Q9)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110558 (H2-Q9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110558 (H2-Q9)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    110558 (H2-Q9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   110558 (H2-Q9)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  110558 (H2-Q9)
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 MHC_I_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 110558
NCBI-ProteinID: NP_001188389
MGI: 95938
UniProt: Q52PG7
Structure
PDB: 
1K8D

Position
17 B1; 17
AA seq 334 aa
MALTMLLLLVAAALTLIETRAGQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSD
AENPRMEPRARWMEQEGPEYWERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMY
GCDMGSDGRLLRGYLQFAYEGRDYIALNEDLKTWTAVDMAAQITRRKWEQAGIAEKDQAY
LEGTCMQSLRRYLELGKETLLRTDPPKAHVTHHPRSYGAVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVNHEGLPEPLTLRWGRWEP
PPYTVSNMATIAVVVDLGAVAIIGAVVAFVMNRR
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggctctaacaatgctgctcttgctggtggcggccgccctgaccctgatcgagacccgc
gcgggccaacactcgctgcaatatttccacaccgctgtgtcccggcccggcctcggggag
ccctggttcatctctgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgat
gcggaaaatccgaggatggagccgcgggcgcggtggatggagcaggaggggccggagtat
tgggagcgggagacacagatcgccaagggccatgagcagagtttccgagggagcctgagg
accgcacagagctactacaaccagagcaagggcggctctcacacactccagtggatgtat
ggctgtgacatggggtccgacgggcgcctcctccgcgggtacctgcagttcgcctatgaa
ggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggtggacatggcg
gcacagatcacccgacgcaagtgggagcaggctggtattgcagagaaagaccaggcctac
ctggagggcacgtgcatgcagtcgctccgcagatacctggagctcgggaaggagacgctg
ctgcgcacagatcccccaaaggcacatgtgacccatcaccccaggtcttatggtgctgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacttggcagttg
aatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgaaccatgaggggctgcctgagccccttaccctgagatgggggagatgggagcct
cctccatacactgtctccaacatggcgaccattgctgttgtggttgaccttggagctgtg
gccatcattggagctgtggtggcttttgtgatgaataggaggtga

KEGG   Mus musculus (mouse): 110696
Entry
110696            CDS       T01002                                 

Gene name
H2-M10.3, 5.3H
Definition
(RefSeq) histocompatibility 2, M region locus 10.3
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110696 (H2-M10.3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110696 (H2-M10.3)
   04145 Phagosome
    110696 (H2-M10.3)
  09143 Cell growth and death
   04218 Cellular senescence
    110696 (H2-M10.3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110696 (H2-M10.3)
   04612 Antigen processing and presentation
    110696 (H2-M10.3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110696 (H2-M10.3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110696 (H2-M10.3)
   05170 Human immunodeficiency virus 1 infection
    110696 (H2-M10.3)
   05168 Herpes simplex virus 1 infection
    110696 (H2-M10.3)
   05163 Human cytomegalovirus infection
    110696 (H2-M10.3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110696 (H2-M10.3)
   05169 Epstein-Barr virus infection
    110696 (H2-M10.3)
   05165 Human papillomavirus infection
    110696 (H2-M10.3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110696 (H2-M10.3)
   05330 Allograft rejection
    110696 (H2-M10.3)
   05332 Graft-versus-host disease
    110696 (H2-M10.3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110696 (H2-M10.3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110696 (H2-M10.3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110696 (H2-M10.3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    110696 (H2-M10.3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   110696 (H2-M10.3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  110696 (H2-M10.3)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 Rio2_N
Other DBs
NCBI-GeneID: 110696
NCBI-ProteinID: NP_963902
MGI: 1276524
Ensembl: ENSMUSG00000058124
Vega: OTTMUSG00000014940
UniProt: Q85ZW6
Position
17 B1; 17 19.01 cM
AA seq 330 aa
MRNPGCCTLLLLLVAMDLNQYCAGSHWLQTFNIAFLEPGMINSRFIHIGYVDSIQYQGFD
SKEPMAILKPRAAWMEQELPKYWNVETTKILLLSQIERRILYFMIEKYEHRMNDYHTLQE
VYGCNVATDGRFLHGHFRLTYYGYDYLTLNEDLSSWTAEGKGAEYMKNRWENMSEAERWK
TYLRGECVQRLLRYLDLGKETLLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITLTW
KRDGNNLTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPP
QTIPIIAILIGLVLGTLVVGTVVIFLVWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaaccctggatgctgcacactcctcctcctcttggtggccatggacctgaaccag
tattgtgcaggctcacactggctgcagactttcaacattgcatttttggagcctggcatg
attaattcccggttcatccacattggctatgtagactctatacagtatcaaggatttgac
agcaaagaaccaatggctattttgaaacctcgggctgcatggatggagcaggaactacct
aagtattggaacgtggagacaacaaaaattctgctattgtcacagatagaaagacgaatt
ctttacttcatgatagaaaaatatgaacatagaatgaacgattatcacaccctgcaggaa
gtatatggctgcaatgtggctactgatgggcgcttccttcacggtcacttccggctcacc
tactatggctacgattacttaaccctgaatgaggacctgagctcctggactgcagagggc
aagggagctgaatacatgaagaacaggtgggagaatatgagtgaggcagaaaggtggaag
acttaccttcgaggggagtgtgtacaaaggcttcttagatacctcgaccttggaaaggag
accttgctgcgctctgatgccccccgaacacatgtgacccaccatgtaagacctgaaggg
aatgtcaccctgaggtgctgggccctaggcttctacccagctgacatcaccctgacctgg
aagagggatgggaacaacctcacccaggacatggagctgccagataccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgagatac
acatgtcatgtgcaccatgaagggttacctgagcctctcactctgaaatgggaacctcca
caaaccatccccatcatagcaatcctcatcggcctggttcttggaactttggtggtggga
actgtggtcatttttctggtgtggaagaaataa

KEGG   Mus musculus (mouse): 14963
Entry
14963             CDS       T01002                                 

Gene name
H2-Bl, H2-B1, H2-Bl-like, H2-D1, H2-K1
Definition
(RefSeq) histocompatibility 2, blastocyst
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14963 (H2-Bl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14963 (H2-Bl)
   04145 Phagosome
    14963 (H2-Bl)
  09143 Cell growth and death
   04218 Cellular senescence
    14963 (H2-Bl)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14963 (H2-Bl)
   04612 Antigen processing and presentation
    14963 (H2-Bl)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14963 (H2-Bl)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14963 (H2-Bl)
   05170 Human immunodeficiency virus 1 infection
    14963 (H2-Bl)
   05168 Herpes simplex virus 1 infection
    14963 (H2-Bl)
   05163 Human cytomegalovirus infection
    14963 (H2-Bl)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14963 (H2-Bl)
   05169 Epstein-Barr virus infection
    14963 (H2-Bl)
   05165 Human papillomavirus infection
    14963 (H2-Bl)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14963 (H2-Bl)
   05330 Allograft rejection
    14963 (H2-Bl)
   05332 Graft-versus-host disease
    14963 (H2-Bl)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14963 (H2-Bl)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14963 (H2-Bl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14963 (H2-Bl)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14963 (H2-Bl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14963 (H2-Bl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14963 (H2-Bl)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2 Omp85
Other DBs
NCBI-GeneID: 14963
NCBI-ProteinID: NP_032225
MGI: 892004
Ensembl: ENSMUSG00000073406
Vega: OTTMUSG00000037291
UniProt: O19440
Position
17 B1; 17 18.89 cM
AA seq 349 aa
MAQRTLFLLLAAALTMIETRAGPHSMRYFETAVFRPGLGEPRFISVGYVDNTQFVSFDSD
AENPRSEPRAPWMEQEGPEYWERETQIAKDNEQSFGWSLRNLIHYYNQSKGGFHTFQRLS
GCDMGLDGRLLRGYLQFAYDGRDYITLNEDLKTWMAADLVALITRRKWEQAGAAELYKFY
LEAECVEWLRRYLQLGKETLLRTDPPKAHVTHHPRPAGDVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPS
TGSNMVNIAVLVVLGAVIIIEAMVAFVLKSSRKIAILPGPAGTKGSSAS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcgcagcgaacgctgttcctgctgctggcggccgccctgactatgatcgagactcgc
gcgggcccacactcgatgcgatatttcgagaccgcagtgttccggcccggcctcggggag
ccccggttcatctctgtcggctacgtggacaacacgcagttcgtgagcttcgacagcgat
gcggagaatccgagatctgagccgcgggcgccgtggatggaacaggagggaccggagtat
tgggagcgggaaacacagatcgccaaggacaatgagcagagtttcggatggagcctgagg
aacctgatccactactacaaccagagcaagggcggctttcacacattccagcggttgtct
ggctgtgacatggggttggacgggcgcctcctccgcgggtacctgcagttcgcttatgat
ggccgcgattacatcaccctgaacgaagacctgaaaacgtggatggcggcggatctggta
gcgctgatcacccgacgcaagtgggagcaggctggtgctgcagagctatacaagttctac
ctggaggccgagtgcgtggagtggctccgcagatacctgcagctcgggaaggagacgctg
ctgcgcacagatcccccaaaggcacatgtgacccatcatcccagacctgcaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgactcaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
accggctccaacatggtaaacatagctgttctggttgtccttggagctgtgatcatcatt
gaagctatggtggcttttgtgttgaagagcagcagaaaaatagccatccttcctggtcca
gcaggcactaagggatcatctgcatcctga

KEGG   Mus musculus (mouse): 14964
Entry
14964             CDS       T01002                                 

Gene name
H2-D1, H-2D, H2-D, H2-K1
Definition
(RefSeq) histocompatibility 2, D region locus 1
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14964 (H2-D1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14964 (H2-D1)
   04145 Phagosome
    14964 (H2-D1)
  09143 Cell growth and death
   04218 Cellular senescence
    14964 (H2-D1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14964 (H2-D1)
   04612 Antigen processing and presentation
    14964 (H2-D1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14964 (H2-D1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14964 (H2-D1)
   05170 Human immunodeficiency virus 1 infection
    14964 (H2-D1)
   05168 Herpes simplex virus 1 infection
    14964 (H2-D1)
   05163 Human cytomegalovirus infection
    14964 (H2-D1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14964 (H2-D1)
   05169 Epstein-Barr virus infection
    14964 (H2-D1)
   05165 Human papillomavirus infection
    14964 (H2-D1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14964 (H2-D1)
   05330 Allograft rejection
    14964 (H2-D1)
   05332 Graft-versus-host disease
    14964 (H2-D1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14964 (H2-D1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14964 (H2-D1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14964 (H2-D1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14964 (H2-D1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14964 (H2-D1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14964 (H2-D1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C ig Ig_2 C2-set_2 Marek_A Omp85
Other DBs
NCBI-GeneID: 14964
NCBI-ProteinID: NP_034510
MGI: 95896
Ensembl: ENSMUSG00000073411
Vega: OTTMUSG00000037094
UniProt: P01899 Q792Z7
Structure
PDB: 

Position
17 B1; 17 18.61 cM
AA seq 362 aa
MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRF
DSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQ
QMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHY
KAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLT
WQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
PPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDC
KA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgggggcgatggctccgcgcacgctgctcctgctgctggcggccgccctggccccgact
cagacccgcgcgggcccacactcgatgcggtatttcgagaccgccgtgtcccggcccggc
ctcgaggagccccggtacatctctgtcggctatgtggacaacaaggagttcgtgcgcttc
gacagcgacgcggagaatccgagatatgagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggagcgggaaacacagaaagccaagggccaagagcagtggttccgagtg
agcctgaggaacctgctcggctactacaaccagagcgcgggcggctctcacacactccag
cagatgtctggctgtgacttggggtcggactggcgcctcctccgcgggtacctgcagttc
gcctatgaaggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcg
gacatggcggcgcagatcacccgacgcaagtgggagcagagtggtgctgcagagcattac
aaggcctacctggagggcgagtgcgtggagtggctccacagatacctgaagaacgggaac
gcgacgctgctgcgcacagattccccaaaggcacatgtgacccatcaccccagatctaaa
ggtgaagtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccgtgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcct
cctccgtccactgactcttacatggtgatcgttgctgttctgggtgtccttggagctatg
gccatcattggagctgtggtggcttttgtgatgaagagaaggagaaacacaggtggaaaa
ggaggggactatgctctggctccaggctcccagagctctgaaatgtctctccgagattgt
aaagcgtga

KEGG   Mus musculus (mouse): 14972
Entry
14972             CDS       T01002                                 

Gene name
H2-K1, H-2K, H-2K(d), H2-D1, H2-K, H2-K_p, K-f
Definition
(RefSeq) histocompatibility 2, K1, K region
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14972 (H2-K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14972 (H2-K1)
   04145 Phagosome
    14972 (H2-K1)
  09143 Cell growth and death
   04218 Cellular senescence
    14972 (H2-K1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14972 (H2-K1)
   04612 Antigen processing and presentation
    14972 (H2-K1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14972 (H2-K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14972 (H2-K1)
   05170 Human immunodeficiency virus 1 infection
    14972 (H2-K1)
   05168 Herpes simplex virus 1 infection
    14972 (H2-K1)
   05163 Human cytomegalovirus infection
    14972 (H2-K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14972 (H2-K1)
   05169 Epstein-Barr virus infection
    14972 (H2-K1)
   05165 Human papillomavirus infection
    14972 (H2-K1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14972 (H2-K1)
   05330 Allograft rejection
    14972 (H2-K1)
   05332 Graft-versus-host disease
    14972 (H2-K1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14972 (H2-K1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14972 (H2-K1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14972 (H2-K1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14972 (H2-K1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14972 (H2-K1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14972 (H2-K1)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig Ig_2 MHC_I_3 C2-set_2 HIG_1_N
Other DBs
NCBI-GeneID: 14972
NCBI-ProteinID: NP_001001892
MGI: 95904
Ensembl: ENSMUSG00000061232
Vega: OTTMUSG00000037104
UniProt: P01901 Q7JJ15
Structure
PDB: 

Position
17 B1; 17 17.98 cM
AA seq 369 aa
MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSD
AENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVIS
GCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAY
LEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQL
NGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPS
TVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKV
MVHDPHSLA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggtaccgtgcacgctgctcctgctgttggcggccgccctggctccgactcagacccgc
gcgggcccacactcgctgaggtatttcgtcaccgccgtgtcccggcccggcctcggggag
ccccggtacatggaagtcggctacgtggacgacacggagttcgtgcgcttcgacagcgac
gcggagaatccgagatatgagccgcgggcgcggtggatggagcaggaggggcccgagtat
tgggagcgggagacacagaaagccaagggcaatgagcagagtttccgagtggacctgagg
accctgctcggctactacaaccagagcaagggcggctctcacactattcaggtgatctct
ggctgtgaagtggggtccgacgggcgactcctccgcgggtaccagcagtacgcctacgac
ggctgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcggacatggcg
gcgctgatcaccaaacacaagtgggagcaggctggtgaagcagagagactcagggcctac
ctggagggcacgtgcgtggagtggctccgcagatacctgaagaacgggaacgcgacgctg
ctgcgcacagattccccaaaggcccatgtgacccatcacagcagacctgaagataaagtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgatccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagtattacacatgc
catgtgtaccatcaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
actgtctccaacatggcgaccgttgctgttctggttgtccttggagctgcaatagtcact
ggagctgtggtggcttttgtgatgaagatgagaaggagaaacacaggtggaaaaggaggg
gactatgctctggctccaggctcccagacctctgatctgtctctcccagattgtaaagtg
atggttcatgaccctcattctctagcgtga

KEGG   Mus musculus (mouse): 14980
Entry
14980             CDS       T01002                                 

Gene name
H2-L, H-2, H-2L
Definition
(RefSeq) histocompatibility 2, D region locus L
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14980 (H2-L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14980 (H2-L)
   04145 Phagosome
    14980 (H2-L)
  09143 Cell growth and death
   04218 Cellular senescence
    14980 (H2-L)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14980 (H2-L)
   04612 Antigen processing and presentation
    14980 (H2-L)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14980 (H2-L)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14980 (H2-L)
   05170 Human immunodeficiency virus 1 infection
    14980 (H2-L)
   05168 Herpes simplex virus 1 infection
    14980 (H2-L)
   05163 Human cytomegalovirus infection
    14980 (H2-L)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14980 (H2-L)
   05169 Epstein-Barr virus infection
    14980 (H2-L)
   05165 Human papillomavirus infection
    14980 (H2-L)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14980 (H2-L)
   05330 Allograft rejection
    14980 (H2-L)
   05332 Graft-versus-host disease
    14980 (H2-L)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14980 (H2-L)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14980 (H2-L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14980 (H2-L)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14980 (H2-L)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14980 (H2-L)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14980 (H2-L)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C ig Ig_2 C2-set_2 Marek_A Gram_pos_anchor
Other DBs
NCBI-GeneID: 14980
NCBI-ProteinID: NP_001254737
MGI: 95912
Structure
PDB: 

Position
17
AA seq 358 aa
MAPRTLLLLLAAAWPDSDPRGPHSMRYFETAVSRPGLGEPRYISVGYVDNKEFVRFDSDA
ENPRYEPQAPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYG
CDVGSDGRLLRGYEQFAYDGRDYIALNEDLKTWTAADMAAQITRRKWEQAGAAEYYRAYL
EGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLN
GEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPHPLTLRWEPPPST
DSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGKGGDYALAPGSQSSEMSLRDCKA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggctccgcgcacgctgctcctgctgctggcggccgcctggcccgactcagacccgcgg
ggcccacactcgatgcggtatttcgagaccgcggtgtcgcggccgggcctcggggagccc
cggtacatctctgtcggctatgtggacaacaaggagttcgtgcgcttcgacagcgacgcg
gagaatccgagatatgagccgcaggcgccgtggatggagcaggaggggccggagtattgg
gagcggatcacgcagatcgccaagggccaggagcagtggttccgagtgaacctgaggacc
ctgctcggctactacaaccagagcgcgggcggcactcacacactccagtggatgtacggc
tgtgacgtggggtcggacgggcgcctcctccgcgggtacgagcagttcgcctacgacggc
cgtgattacatcgccctgaacgaagacctgaaaacgtggacggcggcggacatggcggcg
cagatcacccgacgcaagtgggagcaggctggtgctgcagagtattacagggcctacctg
gagggcgagtgcgtggagtggctccacagatacctgaagaacgggaacgcgacgctgctg
cgcacagattccccaaaggcacatgtgacccatcaccccagatctaaaggtgaagtcacc
ctgaggtgctgggccctgggcttttaccctgctgacatcaccctgacctggcagttgaat
ggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatggaacc
ttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgccgt
gtgtaccatgaggggctgccccatcccctcaccctgagatgggagcctcctccgtccact
gactcttacatggtgatcgttgctgttctgggtgtccttggagctatggccatcattgga
gctgtggtggcttttgtgatgaagagaaggagaaacacaggtggaaaaggaggggactat
gctctggctccaggctcccagagctctgaaatgtctctccgagattgtaaagcgtga

KEGG   Mus musculus (mouse): 14985
Entry
14985             CDS       T01002                                 

Gene name
H2-M10.1, 9.5H
Definition
(RefSeq) histocompatibility 2, M region locus 10.1
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14985 (H2-M10.1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14985 (H2-M10.1)
   04145 Phagosome
    14985 (H2-M10.1)
  09143 Cell growth and death
   04218 Cellular senescence
    14985 (H2-M10.1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14985 (H2-M10.1)
   04612 Antigen processing and presentation
    14985 (H2-M10.1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14985 (H2-M10.1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14985 (H2-M10.1)
   05170 Human immunodeficiency virus 1 infection
    14985 (H2-M10.1)
   05168 Herpes simplex virus 1 infection
    14985 (H2-M10.1)
   05163 Human cytomegalovirus infection
    14985 (H2-M10.1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14985 (H2-M10.1)
   05169 Epstein-Barr virus infection
    14985 (H2-M10.1)
   05165 Human papillomavirus infection
    14985 (H2-M10.1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14985 (H2-M10.1)
   05330 Allograft rejection
    14985 (H2-M10.1)
   05332 Graft-versus-host disease
    14985 (H2-M10.1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14985 (H2-M10.1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14985 (H2-M10.1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14985 (H2-M10.1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14985 (H2-M10.1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14985 (H2-M10.1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14985 (H2-M10.1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_2 Ig_2 Rio2_N
Other DBs
NCBI-GeneID: 14985
NCBI-ProteinID: NP_001347427
MGI: 1276522
Ensembl: ENSMUSG00000024448
Vega: OTTMUSG00000014942
Position
17 B1; 17 19.01 cM
AA seq 288 aa
MRNTGPCTLLLLLMVALDLNHYCAGMQPRAAWIELEPPEYWEKETSRVLELSQVERQVLR
LMVKKNGHKMDGYHTLQEVYGCNVANDGSFLGGHYRLTYYGYDYLTLNEDLSSWTAEGKG
AQHAKSRWEDAGEAKRRKTYLQGECVQRLLRYLDLGKETLLCSDAPQTHVTHHVRPEGNV
TLRCWALGFYPADITMTWKRDGNNLTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTC
HVHHEGLPEPLTLKWEPPHTIPIIAILIGLVLGTLVVGTVVIFLVWRK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaggaacactggaccctgcacactcctgctcctcctgatggtggccttggacctgaac
cactattgtgcagggatgcaacctcgagctgcatggatagagctggagccacctgaatat
tgggaaaaggagacatcaagagttctggaattgtcacaggtagagagacaagttcttcgg
ttaatggtgaaaaaaaatggacacaaaatggatggttatcacaccctgcaggaagtatat
ggctgcaatgtggctaatgatgggagcttcctcggcggtcactaccgactcacctactat
ggctatgattacttaaccctaaatgaggacctgagctcttggactgcagagggcaaggga
gctcaacacgcgaagagcaggtgggaggatgcaggtgaagcaaaacggaggaagacttac
ctgcaaggggagtgtgtacaaaggcttcttagatacctggaccttggaaaggagaccttg
ctgtgctctgatgccccccaaacacatgtgacccaccatgtaagacctgaagggaatgtc
accctgaggtgctgggccttgggcttctacccagctgacatcaccatgacctggaagagg
gatgggaacaacctcacccaggacatggagctgccagacaccaggcctgcaggggatgga
actttccagaagtgggcagctgtggtggttccctctggagaagagctaagatacacatgt
catgtgcaccatgaagggttacctgagcctctcactctaaaatgggagcctccacacacc
atccccatcatagcaattctcatcggcctggttcttggaaccttggtggtgggaactgtg
gtgatttttctggtgtggaggaaataa

KEGG   Mus musculus (mouse): 14990
Entry
14990             CDS       T01002                                 

Gene name
H2-M2, H-2M2, Thy19.4
Definition
(RefSeq) histocompatibility 2, M region locus 2
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14990 (H2-M2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14990 (H2-M2)
   04145 Phagosome
    14990 (H2-M2)
  09143 Cell growth and death
   04218 Cellular senescence
    14990 (H2-M2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14990 (H2-M2)
   04612 Antigen processing and presentation
    14990 (H2-M2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14990 (H2-M2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14990 (H2-M2)
   05170 Human immunodeficiency virus 1 infection
    14990 (H2-M2)
   05168 Herpes simplex virus 1 infection
    14990 (H2-M2)
   05163 Human cytomegalovirus infection
    14990 (H2-M2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14990 (H2-M2)
   05169 Epstein-Barr virus infection
    14990 (H2-M2)
   05165 Human papillomavirus infection
    14990 (H2-M2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14990 (H2-M2)
   05330 Allograft rejection
    14990 (H2-M2)
   05332 Graft-versus-host disease
    14990 (H2-M2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14990 (H2-M2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14990 (H2-M2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14990 (H2-M2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14990 (H2-M2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14990 (H2-M2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14990 (H2-M2)
SSDB
Motif
Pfam: MHC_I C1-set ig
Other DBs
NCBI-GeneID: 14990
NCBI-ProteinID: NP_001334316
MGI: 95914
Ensembl: ENSMUSG00000016283
Vega: OTTMUSG00000037432
UniProt: Q6W9L1
Position
17 B1; 17 19.16 cM
AA seq 343 aa
METSAFFTLLFTLYLLLGASLALAQTFKGSHSLRYFDIAVSRPGLEETHYMTVGYVDDTE
FVHFDNEAENPRFEPRVPWMEQMGQKYWDDQTRIAKAAEQQIRVYFQKLRDYYNQSQNSS
HTIQRMTGCYIGPDGHLLHAYRQFGYDGQDYLTLNEDLSTWTAADAAAEITRREWEATNV
AEFWRVYLEGPCMVWLFKYLTVGNETLLRTEPPKAYVTHHPRPEGDVTLRCWALGFYPSD
IIMIWQRDGEDQTQDMDVIETRPAGDGTFQKWVAVVVPSGKEQNYTCHVAHEGLPEPLTL
RWSRPPQSFIFIIIVAVGLVLLGASVATLVMWKKSSGGERGSL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagacttcagcattcttcactctcctcttcactctctacctgctgcttggggcttcc
cttgccctggcacagacctttaaaggatcccactccttgcggtacttcgacatcgcagtg
tcaagacctggcctagaggagacccactacatgactgttggctatgtggatgacacagag
tttgtgcattttgacaatgaggctgagaatccgaggtttgagccccgagtgccttggatg
gaacagatgggacagaagtactgggatgaccagacacgcattgcgaaagctgcagaacag
cagattagagtgtactttcagaaactgcgagactactacaaccagagccagaacagttct
cacaccatccaaaggatgactggctgctacattggaccagacgggcacctacttcacgca
taccgtcagtttggttatgatgggcaagattacctcactctgaatgaagatctgagcacc
tggactgcagcagatgcggcagctgagatcacccgtagagagtgggaggcaactaatgtg
gctgagttctggagggtctacttggagggcccttgcatggtgtggctctttaaatacctg
acagtgggaaatgagactctactgcgcacagagcccccaaaggcatatgtgacccatcac
cccagacctgaaggtgatgtcaccctgaggtgctgggccctgggtttctacccttctgac
atcatcatgatctggcaaagagatggggaggaccagacccaggacatggatgttattgag
accagacctgcaggggatggaaccttccagaagtgggtagctgtggtggtgccttctggg
aaggagcagaattacacatgccatgtggctcatgagggactgcctgagcccctcaccctg
agatggagtagacctcctcagtctttcattttcatcataatagttgctgttggcctggtt
ctcctgggagcttcagtggctactcttgtcatgtggaagaagagctcgggtggggaaagg
ggcagcctctga

KEGG   Mus musculus (mouse): 14991
Entry
14991             CDS       T01002                                 

Gene name
H2-M3, H-2M3, Hmt, M3a, MuprM3, MuprM301, MuprM302, R4B, R4B2
Definition
(RefSeq) histocompatibility 2, M region locus 3
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14991 (H2-M3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14991 (H2-M3)
   04145 Phagosome
    14991 (H2-M3)
  09143 Cell growth and death
   04218 Cellular senescence
    14991 (H2-M3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14991 (H2-M3)
   04612 Antigen processing and presentation
    14991 (H2-M3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14991 (H2-M3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14991 (H2-M3)
   05170 Human immunodeficiency virus 1 infection
    14991 (H2-M3)
   05168 Herpes simplex virus 1 infection
    14991 (H2-M3)
   05163 Human cytomegalovirus infection
    14991 (H2-M3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14991 (H2-M3)
   05169 Epstein-Barr virus infection
    14991 (H2-M3)
   05165 Human papillomavirus infection
    14991 (H2-M3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14991 (H2-M3)
   05330 Allograft rejection
    14991 (H2-M3)
   05332 Graft-versus-host disease
    14991 (H2-M3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14991 (H2-M3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14991 (H2-M3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14991 (H2-M3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14991 (H2-M3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14991 (H2-M3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14991 (H2-M3)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 Ig_2 ig C2-set_2
Other DBs
NCBI-GeneID: 14991
NCBI-ProteinID: NP_038847
MGI: 95915
Ensembl: ENSMUSG00000016206
Vega: OTTMUSG00000037377
UniProt: Q31093
Structure
PDB: 
1MHC

Position
17 B1; 17 19.16 cM
AA seq 336 aa
MGSSSNRALLHMVVVSLAVTQTGSGSHSLRYFHTAVSRPGRGEPQYISVGYVDDVQFQRC
DSIEEIPRMEPRAPWMEKERPEYWKELKLKVKNIAQSARANLRTLLRYYNQSEGGSHILQ
WMVSCEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAVDMVSQITKSRLESAGTAEYF
RAYVEGECLELLHRFLRNGKEILQRADPPKAHVAHHPRPKGDVTLRCWALGFYPADITLT
WQKDEEDLTQDMELVETRPSGDGTFQKWAAVVVPSGEEQRYTCYVHHEGLTEPLALKWGR
SSQSSVVIMVIVASLVLLGGVITIVVVCKRRGAGER
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggggtcctcaagcaaccgcgctctcctgcacatggtggtggtctctttggctgttacc
caaacaggttctggctcacattcactgcgctatttccacactgcggtgtcacggccgggc
cgtggggagccccagtatatctctgtgggctatgttgacgacgtgcagtttcagcgctgt
gatagcattgaggaaattccgaggatggaacctcgtgcaccttggatggagaaggaaaga
ccagagtactggaaggagctgaaactcaaggtcaagaatattgcacaaagtgccagagca
aaccttcggaccctgctccgctactacaaccagagtgaaggcggctctcacatcctgcag
tggatggtttcctgtgaggtagggccagacatgcgccttcttggagcccactatcaggct
gcgtatgatggctcagattacatcaccctgaatgaagacctgagctcctggactgcagtg
gacatggtgtctcagatcacgaagagccgtttagagtcagctggcacagcagagtacttc
agggcctatgtggagggagagtgcctggagctgctccacagattcctgcggaatggcaag
gagattcttcagcgagcagatcccccaaaggcacatgtggcccatcacccgagacccaaa
ggtgatgttaccttgaggtgctgggctctgggcttctaccctgctgacatcaccctgacc
tggcagaaggatgaagaggacctgacccaggacatggagcttgtggaaacgaggccttca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacatgttatgtgcaccatgaggggctaaccgagccccttgccctgaaatggggaaga
tcgtctcaatcatctgtcgtcatcatggtcatcgttgctagtctggttctcctgggaggt
gtgatcactattgttgtggtgtgcaagaggaggggtgcaggggaaagatga

KEGG   Mus musculus (mouse): 14997
Entry
14997             CDS       T01002                                 

Gene name
H2-M9, M9
Definition
(RefSeq) histocompatibility 2, M region locus 9
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14997 (H2-M9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14997 (H2-M9)
   04145 Phagosome
    14997 (H2-M9)
  09143 Cell growth and death
   04218 Cellular senescence
    14997 (H2-M9)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14997 (H2-M9)
   04612 Antigen processing and presentation
    14997 (H2-M9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14997 (H2-M9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14997 (H2-M9)
   05170 Human immunodeficiency virus 1 infection
    14997 (H2-M9)
   05168 Herpes simplex virus 1 infection
    14997 (H2-M9)
   05163 Human cytomegalovirus infection
    14997 (H2-M9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14997 (H2-M9)
   05169 Epstein-Barr virus infection
    14997 (H2-M9)
   05165 Human papillomavirus infection
    14997 (H2-M9)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14997 (H2-M9)
   05330 Allograft rejection
    14997 (H2-M9)
   05332 Graft-versus-host disease
    14997 (H2-M9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14997 (H2-M9)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14997 (H2-M9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14997 (H2-M9)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14997 (H2-M9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14997 (H2-M9)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14997 (H2-M9)
SSDB
Motif
Pfam: MHC_I Ilm1
Other DBs
NCBI-GeneID: 14997
NCBI-ProteinID: NP_001355246
MGI: 1276570
Ensembl: ENSMUSG00000067201
Vega: OTTMUSG00000014939
Position
17 B1; 17 19.16 cM
AA seq 244 aa
MKNFESQPLLLLFMVTLVIAKHPNGSHTLRFVSTFLSWPRHLELQFIFLIYVDETQIMGF
NSISESQRMESRVPWLNELNAEFWELATQDVLKEKSFVTGIMNKLLHIYNDSMTGYHIIQ
ETYGCQVKQRTYFSHAFMELLFDTHDYITLNEDLQTWRAVGKAAEIVKEEWEKINLVKSS
KSFLLGACVEGLLQYLNFGKKYLLRTDPPEPTIPFLPMIIALVLGALLMGSVMTFLIWKR
RTRG
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaagaactttgaatcccagcctctcctcctgctgttcatggtcaccttggtcatcgca
aagcatccaaatggttcacacactctgagatttgtgtccaccttcttatcatggcctcga
catctggagctgcagtttatctttctcatctatgtggatgaaacacagatcatgggattc
aacagtatatcagagagtcagaggatggagagtcgggtaccatggttgaatgagctaaat
gcagagttttgggagttggcaacacaggatgtcctgaaagaaaaaagcttcgtgacagga
attatgaacaaattgctccacatctataatgatagcatgactggatatcacataatccag
gaaacatatggctgccaagtcaagcagagaacgtacttcagtcacgccttcatggaatta
ttattcgatacacatgattacatcacactgaatgaggatctgcaaacatggagagcggtt
ggcaaggcagctgagatagttaaggaagagtgggagaaaataaatcttgtaaagtcgtca
aagtctttcctgctgggtgcatgtgtggaggggctccttcaatacctgaactttgggaag
aagtatttgctgagaacagatcctcctgaacccaccatccccttcctgcctatgattatt
gctctggttcttggggctctgcttatgggatcagtgatgacttttcttatatggaagaga
aggactagaggttaa

KEGG   Mus musculus (mouse): 15006
Entry
15006             CDS       T01002                                 

Gene name
H2-Q1, H-2Q1, H2-D1, Q1, Q1b, Q1d, Q1k, Qa-1, Qa1, Qed-1
Definition
(RefSeq) histocompatibility 2, Q region locus 1
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15006 (H2-Q1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15006 (H2-Q1)
   04145 Phagosome
    15006 (H2-Q1)
  09143 Cell growth and death
   04218 Cellular senescence
    15006 (H2-Q1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15006 (H2-Q1)
   04612 Antigen processing and presentation
    15006 (H2-Q1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15006 (H2-Q1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15006 (H2-Q1)
   05170 Human immunodeficiency virus 1 infection
    15006 (H2-Q1)
   05168 Herpes simplex virus 1 infection
    15006 (H2-Q1)
   05163 Human cytomegalovirus infection
    15006 (H2-Q1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15006 (H2-Q1)
   05169 Epstein-Barr virus infection
    15006 (H2-Q1)
   05165 Human papillomavirus infection
    15006 (H2-Q1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15006 (H2-Q1)
   05330 Allograft rejection
    15006 (H2-Q1)
   05332 Graft-versus-host disease
    15006 (H2-Q1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15006 (H2-Q1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15006 (H2-Q1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15006 (H2-Q1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15006 (H2-Q1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15006 (H2-Q1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15006 (H2-Q1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Marek_A Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 15006
NCBI-ProteinID: NP_001345719
MGI: 95928
Ensembl: ENSMUSG00000079507
Vega: OTTMUSG00000037097
Position
17 B1; 17 18.63 cM
AA seq 341 aa
MALGRLLLLLAAALTLTKTGAGSHSLRYFETSVSRPGFGKPRFISVGYVDDTQFVRFDSD
AKNPRYEPRAPWMEQEGPEYWERNTRRVKGSEKRFQESLSTLLSYYNQSKGGIHTFQKLS
GCDLGSDGRLQSGYLQFAYDGLDYIALNEDLETWTAADVAAQETRRKWEQAGAAEKHRTY
LEGKCLMWLHRYLELGKEMLLRTDPPKAHVTHHPRSQGDVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPY
TVSNMVIIAVLVVLGAVIVIGAVVIIGVMVSFVMKRRRNKA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcactgggaaggctgctcctgctgctggcagccgccctgaccctgaccaaaaccgga
gcgggctcacactcgctgcggtatttcgagacctcggtgtcccggcccggcttcgggaag
ccccggttcatctctgtcggctacgtggacgacacgcagtttgtgcgcttcgacagcgac
gcgaagaatccgagatatgagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggaacggaacacacggagagtcaagggcagtgagaagagattccaagagagcctgagc
accctgctcagctactacaaccagagcaagggcggcattcacaccttccagaagttgtct
ggctgtgatctggggtcagatgggcgccttcaaagcgggtacctgcagttcgcctatgat
ggccttgattacatcgccctgaatgaagacctggaaacctggacagcagcagatgtggca
gctcaggaaacccgacgcaagtgggagcaggctggtgctgctgagaaacacaggacctac
ctggagggcaagtgcctgatgtggctccacagatacctggagctcgggaaggagatgctg
ctgcgcacagaccccccaaaggcacatgtgactcatcaccccagatctcaaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatac
actgtttccaacatggtaatcatagctgttctggttgtccttggagctgtgatagtcatt
ggagctgtggtcatcattggagttatggtgtcttttgtgatgaagaggaggagaaacaaa
gcatga

KEGG   Mus musculus (mouse): 15007
Entry
15007             CDS       T01002                                 

Gene name
H2-Q10, H-2Q10, H2-K1, Q10, Qa1, Qa10
Definition
(RefSeq) histocompatibility 2, Q region locus 10
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15007 (H2-Q10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15007 (H2-Q10)
   04145 Phagosome
    15007 (H2-Q10)
  09143 Cell growth and death
   04218 Cellular senescence
    15007 (H2-Q10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15007 (H2-Q10)
   04612 Antigen processing and presentation
    15007 (H2-Q10)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15007 (H2-Q10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15007 (H2-Q10)
   05170 Human immunodeficiency virus 1 infection
    15007 (H2-Q10)
   05168 Herpes simplex virus 1 infection
    15007 (H2-Q10)
   05163 Human cytomegalovirus infection
    15007 (H2-Q10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15007 (H2-Q10)
   05169 Epstein-Barr virus infection
    15007 (H2-Q10)
   05165 Human papillomavirus infection
    15007 (H2-Q10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15007 (H2-Q10)
   05330 Allograft rejection
    15007 (H2-Q10)
   05332 Graft-versus-host disease
    15007 (H2-Q10)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15007 (H2-Q10)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15007 (H2-Q10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15007 (H2-Q10)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15007 (H2-Q10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15007 (H2-Q10)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15007 (H2-Q10)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 15007
NCBI-ProteinID: NP_034521
MGI: 95929
Ensembl: ENSMUSG00000067235
Vega: OTTMUSG00000037234
UniProt: P01898
Structure
PDB: 
5J6H 5J6G

Position
17 B1; 17 18.68 cM
AA seq 325 aa
MGAMAPRTLLLLLAAALAPTQTQAGSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRF
DSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQ
WMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYY
RAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGSEGDVTLRCWALGFYPADITLT
WQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEP
PPSTDSIMSHIADLLWPSLKLWWYL
NT seq 978 nt   +upstreamnt  +downstreamnt
atgggggcgatggcgccgcgcacgctgctcctgctgctggcggctgccctggccccgacc
cagacccaggcaggctcacactccatgaggtatttcgaaacctccgtttcccggccgggc
cttggggagccccggttcattattgtcggttacgtggacgacacgcagttcgtgcgcttc
gacagcgacgcggagactccgaggatggagccgcgggcgccttggatggagcaggagggg
ccggagtattgggagcgggagacacagagagccaagggcaatgagcagagtttccatgtg
agcctgaggaccctgctcggctactacaaccagagcgagagcggctctcacacgatccag
tggatgtatggctgtaaagtggggtccgacgggcgcttcctccgcgggtacctgcaatac
gcatacgacggccgcgattacattgccctgaacgaagacctgaaaacgtggacggcagcg
gacgtggcggcgattatcacccgacgcaagtgggagcaggctggtgctgcagagtattac
agggcctacctggaggccgagtgcgtggagtggctcctcagatacctggagctcgggaag
gagacgctgctgcgcacagatcccccaaagacacatgtgacccatcacccaggatctgaa
ggtgatgtcaccctgaggtgttgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggagctgacccaggacatggaactggtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccatgtgtaccatgaggggctgcctgagcccctcaccctgagatgggaacct
cctccttccactgactctatcatgtcacacattgctgatctgctgtggccatcattaaag
ctctggtggtatttgtga

KEGG   Mus musculus (mouse): 15013
Entry
15013             CDS       T01002                                 

Gene name
H2-Q2, BE136769, Gm11132, H-2Q2, H2-D1, H2-K1, gs14-2
Definition
(RefSeq) histocompatibility 2, Q region locus 2
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15013 (H2-Q2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15013 (H2-Q2)
   04145 Phagosome
    15013 (H2-Q2)
  09143 Cell growth and death
   04218 Cellular senescence
    15013 (H2-Q2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15013 (H2-Q2)
   04612 Antigen processing and presentation
    15013 (H2-Q2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15013 (H2-Q2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15013 (H2-Q2)
   05170 Human immunodeficiency virus 1 infection
    15013 (H2-Q2)
   05168 Herpes simplex virus 1 infection
    15013 (H2-Q2)
   05163 Human cytomegalovirus infection
    15013 (H2-Q2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15013 (H2-Q2)
   05169 Epstein-Barr virus infection
    15013 (H2-Q2)
   05165 Human papillomavirus infection
    15013 (H2-Q2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15013 (H2-Q2)
   05330 Allograft rejection
    15013 (H2-Q2)
   05332 Graft-versus-host disease
    15013 (H2-Q2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15013 (H2-Q2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15013 (H2-Q2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15013 (H2-Q2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15013 (H2-Q2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15013 (H2-Q2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15013 (H2-Q2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Psg1
Other DBs
NCBI-GeneID: 15013
NCBI-ProteinID: NP_001355669
MGI: 95931
Ensembl: ENSMUSG00000091705
Vega: OTTMUSG00000037101
Position
17 B1; 17 18.64 cM
AA seq 346 aa
MALRRLLLLLVAALKLTETRAGSHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSD
AENPRMEPRAPWMEQEGPEYWERNTQVSKENEQSFRVSLGTALSYYNQSKGGSHTLQWLV
GCDLGPDGSLLRGYEQSAYDGRDYLALNEDLITWTAADLAALKTRSKLEQAGLAEKRRAY
LEVDCLTWLRRYLELGKETLLHTDPPKAHVTHHPSSQGDVTLRCWALGFYPADITLTWQL
NGEDLTQDMELVETRPSGDGTFQKWASVMVPFGEEPRYTCHVEHEGLPEPLTLRWEPPPS
TDSYMVIIAVLVVLGAVIIIGAVVAFVMKRGRNTGGKVRDYAQDPA
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcgctgcgaaggctgctcctgctgttggtggccgccctgaaactgactgagacacgc
gcgggctcacactcgctgcggtatttcaccaccgccgtgtcccggcctggcctcggggag
ccccggttcattatcgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgac
gcggagaatccgaggatggagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggagcggaacacacaggtctccaaggaaaatgagcagagtttccgagtgagcctgggg
accgcactgagctactacaaccagagcaagggaggctctcacactctccagtggttggtt
ggctgtgacctggggccagacggaagcctactccgagggtatgagcagtctgcctacgat
ggccgcgattacctcgccctgaatgaggatctgataacgtggacagcggcggacctggca
gcactgaagacccgaagcaagttggagcaggctggtcttgcagagaagcgcagggcctac
ctggaggtcgattgcttgacgtggctccgcagatacctggagctcgggaaggagacgctg
ctgcacacagatcccccaaaggcgcatgtgacccatcaccccagttctcaaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggacctgacccaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggcatctgtgatggtgccttttggggaggagcctagatacacatgc
catgtggaacatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
actgactcttacatggtgatcattgctgttctggttgtccttggagctgtgatcatcatt
ggagctgtggtggcttttgtgatgaaaagagggagaaacacaggtggaaaagtaagagac
tacgctcaagatccagcatga

KEGG   Mus musculus (mouse): 15015
Entry
15015             CDS       T01002                                 

Gene name
H2-Q4, H-2Q4, H2-D1, H2-Gs1, H2-Gs10, Qa, Qa-, Qa-4, Qa4, Qat-, Qat-4, Qb-1, Qb1
Definition
(RefSeq) histocompatibility 2, Q region locus 4
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15015 (H2-Q4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15015 (H2-Q4)
   04145 Phagosome
    15015 (H2-Q4)
  09143 Cell growth and death
   04218 Cellular senescence
    15015 (H2-Q4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15015 (H2-Q4)
   04612 Antigen processing and presentation
    15015 (H2-Q4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15015 (H2-Q4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15015 (H2-Q4)
   05170 Human immunodeficiency virus 1 infection
    15015 (H2-Q4)
   05168 Herpes simplex virus 1 infection
    15015 (H2-Q4)
   05163 Human cytomegalovirus infection
    15015 (H2-Q4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15015 (H2-Q4)
   05169 Epstein-Barr virus infection
    15015 (H2-Q4)
   05165 Human papillomavirus infection
    15015 (H2-Q4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15015 (H2-Q4)
   05330 Allograft rejection
    15015 (H2-Q4)
   05332 Graft-versus-host disease
    15015 (H2-Q4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15015 (H2-Q4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15015 (H2-Q4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15015 (H2-Q4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15015 (H2-Q4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15015 (H2-Q4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15015 (H2-Q4)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_3 Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 15015
NCBI-ProteinID: NP_001137161
MGI: 95933
Ensembl: ENSMUSG00000035929
Vega: OTTMUSG00000037138
UniProt: Q8HWB2 Q0WXH7
Position
17 B1; 17 18.65 cM
AA seq 354 aa
MASTMLLLLVAVAQTLIEIRAAPRPAPLPARSPAGGPGRSSGSHRALPPGPHLLSYFYTS
VSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGNE
QIFRVNLRTLLSYYNQSAGGSHTIQVISGCEVGSDGRLLRGYQQFAYDGRDYIALNEDLK
TWTAADMAAQITRRKWEQAGATEKSKAYLEGACVQSLRRYLELGKETLLRTDPPKAHVTC
HHRSDGDVTLRCWALGFYPANIILTWQLNGEELTQDMELVETRPSGDGTFQKWASVVVPL
GKEQNYTCHVHHEGLPEPLTLRWEPPPSTVSNMANVAVLVVLGAWPSLQLWWLL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggcgtcaacaatgctgcttctgctggtggcagtcgcccagaccctgatcgagatccgc
gcggccccgcgccctgctcccctcccggcccgctcacccgccgggggtcccggaaggagt
tcggggtctcaccgcgccctgcctccaggcccacacttgctgagttatttctacacctcc
gtgtcccggccgggccttggggagccccggttcatctctgtcggttacgtggacaacacg
gagttcgtgcgcttcgacagcgacgcggagaatccgagatatgagccgcgggcaccgtgg
atggagcaggaggggccggagtattgggagcgggaaacacagaaagccaagggcaatgag
cagattttccgagtgaacctgaggaccctgctcagctactacaaccagagcgcgggcggc
tctcacactattcaggtgatctctggctgtgaagtggggtccgacgggcgcctcctccgc
gggtaccagcagttcgcctacgacggccgcgattacatcgccctgaacgaagacctgaaa
acgtggacggcggcggacatggcggcacagatcacccgacgcaagtgggagcaggctggt
gctacagagaaaagcaaggcctacctggagggcgcgtgcgtgcagtccctccgcagatac
ctggagctcgggaaggagacgctgctgcgcacagatcctccaaaggcacatgtgacatgt
caccacagatctgacggtgatgtcaccctgaggtgctgggccctgggcttctaccctgct
aacatcatcctgacctggcagttgaatggggaggagctgacccaggacatggagcttgtg
gagaccaggccttcaggggatggaaccttccagaagtgggcatctgtggtggtgcctctt
gggaaggagcagaattacacatgccatgtgcaccatgaggggctgcctgagcccctcacc
ctgagatgggagcctcctccatccactgtctccaacatggcgaacgtagctgttctggtt
gtccttggagcttggccatcattgcagctgtggtggcttttgtga

KEGG   Mus musculus (mouse): 15018
Entry
15018             CDS       T01002                                 

Gene name
H2-Q7, H-2Q7, Pe, Ped, Q9, Qa, Qa-, Qa-2, Qa-7, Qa7
Definition
(RefSeq) histocompatibility 2, Q region locus 7
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15018 (H2-Q7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15018 (H2-Q7)
   04145 Phagosome
    15018 (H2-Q7)
  09143 Cell growth and death
   04218 Cellular senescence
    15018 (H2-Q7)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15018 (H2-Q7)
   04612 Antigen processing and presentation
    15018 (H2-Q7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15018 (H2-Q7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15018 (H2-Q7)
   05170 Human immunodeficiency virus 1 infection
    15018 (H2-Q7)
   05168 Herpes simplex virus 1 infection
    15018 (H2-Q7)
   05163 Human cytomegalovirus infection
    15018 (H2-Q7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15018 (H2-Q7)
   05169 Epstein-Barr virus infection
    15018 (H2-Q7)
   05165 Human papillomavirus infection
    15018 (H2-Q7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15018 (H2-Q7)
   05330 Allograft rejection
    15018 (H2-Q7)
   05332 Graft-versus-host disease
    15018 (H2-Q7)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15018 (H2-Q7)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15018 (H2-Q7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15018 (H2-Q7)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15018 (H2-Q7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15018 (H2-Q7)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15018 (H2-Q7)
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 15018
NCBI-ProteinID: NP_034524
MGI: 95936
Ensembl: ENSMUSG00000060550
Vega: OTTMUSG00000037191
UniProt: P14429
Position
17 B1; 17 18.67 cM
AA seq 334 aa
MALTMLLLLVAAALTLIETRAGQHSLQYFHTAVSRPGLGEPWFISVGYVDDTQFVRFDSD
AENPRMEPRARWMEQEGPEYWERETQIAKGHEQSFRGSLRTAQSYYNQSKGGSHTLQWMY
GCDMGSDGRLLRGYLQFAYEGRDYIALNEDLKTWTAVDMAAQITRRKWEQAGIAEKDQAY
LEGTCMQSLRRYLQLGKETLLRTDPPKAHVTHHPRSYGAVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVNHEGLPEPLTLRWGRWEP
PPYTVSNMATIAVVVDLGAVAIIGAVVAFVMNRR
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggctctaacaatgctgctcttgctggtggcggccgccctgaccctgatcgagacccgc
gcgggccaacactcgctgcaatatttccacaccgctgtgtcccggcccggcctcggggag
ccctggttcatctctgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgat
gcggaaaatccgaggatggagccgcgggcgcggtggatggagcaggaggggccggagtat
tgggagcgggagacacagatcgccaagggccatgagcagagtttccgagggagcctgagg
accgcacagagctactacaaccagagcaagggcggctctcacacactccagtggatgtat
ggctgtgacatggggtccgacgggcgcctcctccgcgggtacctgcagttcgcctatgaa
ggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggtggacatggcg
gcacagatcacccgacgcaagtgggagcaggctggtattgcagagaaagaccaggcctac
ctggagggcacgtgcatgcagtcgctccgcagatacctgcagctcgggaaggagacgctg
ctgcgcacagatcccccaaaggcacatgtgacccatcaccccaggtcttatggtgctgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacttggcagttg
aatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgaaccatgaggggctgcctgagccccttaccctgagatgggggagatgggagcct
cctccatacactgtctccaacatggcgaccattgctgttgtggttgaccttggagctgtg
gccatcattggagctgtggtggcttttgtgatgaataggaggtga

KEGG   Mus musculus (mouse): 15019
Entry
15019             CDS       T01002                                 

Gene name
H2-Q8, H-2Q8, MMS10-T, Ms10t, Qa, Qa-, Qa-2, Qa-8, Qa8
Definition
(RefSeq) histocompatibility 2, Q region locus 8
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15019 (H2-Q8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15019 (H2-Q8)
   04145 Phagosome
    15019 (H2-Q8)
  09143 Cell growth and death
   04218 Cellular senescence
    15019 (H2-Q8)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15019 (H2-Q8)
   04612 Antigen processing and presentation
    15019 (H2-Q8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15019 (H2-Q8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15019 (H2-Q8)
   05170 Human immunodeficiency virus 1 infection
    15019 (H2-Q8)
   05168 Herpes simplex virus 1 infection
    15019 (H2-Q8)
   05163 Human cytomegalovirus infection
    15019 (H2-Q8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15019 (H2-Q8)
   05169 Epstein-Barr virus infection
    15019 (H2-Q8)
   05165 Human papillomavirus infection
    15019 (H2-Q8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15019 (H2-Q8)
   05330 Allograft rejection
    15019 (H2-Q8)
   05332 Graft-versus-host disease
    15019 (H2-Q8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15019 (H2-Q8)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15019 (H2-Q8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15019 (H2-Q8)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15019 (H2-Q8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15019 (H2-Q8)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15019 (H2-Q8)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 15019
NCBI-ProteinID: NP_075613
MGI: 95937
UniProt: P79567
Position
17 B1; 17
AA seq 326 aa
MALTTLLLLVAAALTLIETRAGPHSLRYFHTAVSWPGLVEPRFIIVGYVDDTQFVRFDSD
AENPRMEPRARWMEQEGPEYWERETQKAKGHEESFRVSLRTAQRYYNQSKGGSHTLQWMY
GCDVGSDERLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITLHKWEQAGIAERDRAY
LEGACVQSLRRYLQLRKETLLCTDPPKAHVTHHPRSYGAVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVNHEGLPEPLTLRWEPPPS
TVSNMANVAILVVLVAWPSLELWWIL
NT seq 981 nt   +upstreamnt  +downstreamnt
atggctctaacaacgctgctcttgctggtggcggccgccctgaccctgatcgagacccgc
gcgggcccacactcgctgcggtatttccacactgctgtgtcctggcccggcctcgtggag
ccccggttcattatcgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgac
gcggaaaatccgaggatggagccgcgggcgcggtggatggagcaggaggggccggagtat
tgggagcgggagacacagaaagccaagggccatgaggagagtttccgagtgagcctgagg
accgcacagagatactacaaccagagcaagggcggctctcacacactccagtggatgtat
ggctgtgacgtggggtccgacgagcgcctcctccgcgggtacctgcagttcgcctatgaa
ggccgcgattacatcgccctgaacgaagacctgaaaacctggacggcggcggacatggct
gcacagatcaccctacacaagtgggagcaggctggtattgcagagagagaccgggcctac
ctggagggcgcttgcgtgcagtcgctccgcagatacctgcagctccggaaggagacgctg
ctgtgcacagatcccccaaaggcacatgtgacccatcaccccaggtcttatggtgctgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacttggcagttg
aatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtgaaccatgaggggctgcctgagcctctcaccctgagatgggagcctcctccatcc
actgtctccaacatggcgaacgtagctattctggttgtccttgtagcttggccatcattg
gagctgtggtggattttgtga

KEGG   Mus musculus (mouse): 15024
Entry
15024             CDS       T01002                                 

Gene name
H2-T10, H-2T10
Definition
(RefSeq) histocompatibility 2, T region locus 10
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15024 (H2-T10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15024 (H2-T10)
   04145 Phagosome
    15024 (H2-T10)
  09143 Cell growth and death
   04218 Cellular senescence
    15024 (H2-T10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15024 (H2-T10)
   04612 Antigen processing and presentation
    15024 (H2-T10)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15024 (H2-T10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15024 (H2-T10)
   05170 Human immunodeficiency virus 1 infection
    15024 (H2-T10)
   05168 Herpes simplex virus 1 infection
    15024 (H2-T10)
   05163 Human cytomegalovirus infection
    15024 (H2-T10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15024 (H2-T10)
   05169 Epstein-Barr virus infection
    15024 (H2-T10)
   05165 Human papillomavirus infection
    15024 (H2-T10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15024 (H2-T10)
   05330 Allograft rejection
    15024 (H2-T10)
   05332 Graft-versus-host disease
    15024 (H2-T10)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15024 (H2-T10)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15024 (H2-T10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15024 (H2-T10)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15024 (H2-T10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15024 (H2-T10)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15024 (H2-T10)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2 GTF2I Mucin
Other DBs
NCBI-GeneID: 15024
NCBI-ProteinID: NP_034525
MGI: 95942
Ensembl: ENSMUSG00000079491
UniProt: Q8WLM9
Structure
PDB: 
1R3H

Position
17 B1; 17 18.93 cM
AA seq 377 aa
MSWVLRAAVVCALLLQLDARSSWIPLGSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQVL
RFSSKEETPRMAPWLEQEEADDWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTLQW
LQGCDVEPDRHLCLWYNQLAYDSEDLPTLSENPSSCTVGNSTVPQISQHLEGHCSDLLQK
YLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQKDGEELTQDMEF
VETRPAGDGTFQKWAAVVVPLGKVQSYTCHVDHEGLPEPLTLRWEPAWYQKPWIWIVATV
FSILLICLCVARICMKKNAGGRGRRDTQEAGRDSPQDSSKTVVDDEEMGVCFWKIKYCKT
CLGHSSGTSVGESLLSP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtcctgggtcctcagggccgctgtggtctgcgcccttctcctgcagctggatgccaga
tcatcctggatccctttgggttcacactcgcttaggtatttctacaccgctgtgtcccgg
cctggccttggggagccctggttcataatcgtcggctatgtggacgacatgcaggtcctg
cgcttcagcagcaaggaggagactccaaggatggcaccctggctggagcaggaggaagca
gatgactgggagcagcagactcgtatagtcacaattcaaggacagctgtctgaaaggaat
ctgatgaccctggttcatttttacaacaagagcatggacgactctcacacactacagtgg
ctgcaaggctgcgatgtggagccagatcggcacctgtgtctctggtacaaccagctcgcc
tatgatagcgaggatctccccaccctgagcgaaaacccaagttcctgtacagtgggaaac
agcactgtacctcagatctctcagcacctggagggccactgctcagacctgctgcagaaa
tacctggaaaaagggaaagagaggctgctgcgttcagaccccccaaaggcacatgtgacc
cgtcaccccagacctgaaggtgatgtcaccctgaggtgctgggccctgggtttctaccct
gctgacatcaccctgacctggcagaaggatggggaggagctgacccaagacatggagttt
gtggagaccaggcctgcaggggatggaaccttccagaagtgggcagctgtggtggtgccg
cttggaaaggtgcagagttacacgtgccatgtggaccatgaggggctgcctgagcccctc
accctgagatgggagcctgcatggtaccaaaagccttggatttggattgttgccacggtt
ttttccattttgctcatttgtctctgtgtggctcgcatatgcatgaagaagaatgcaggt
gggagaggaaggcgtgacacccaagaagcaggcagagacagtccccaagactctagcaag
actgttgtggatgatgaggagatgggggtttgcttttggaagattaagtactgtaagact
tgtctaggccactcctcaggaacttcagttggcgagtctttactgtcaccttga

KEGG   Mus musculus (mouse): 15039
Entry
15039             CDS       T01002                                 

Gene name
H2-T22, 27b, H-2T17, H-2T22, H2-T17, T22b
Definition
(RefSeq) histocompatibility 2, T region locus 22
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15039 (H2-T22)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15039 (H2-T22)
   04145 Phagosome
    15039 (H2-T22)
  09143 Cell growth and death
   04218 Cellular senescence
    15039 (H2-T22)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15039 (H2-T22)
   04612 Antigen processing and presentation
    15039 (H2-T22)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15039 (H2-T22)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15039 (H2-T22)
   05170 Human immunodeficiency virus 1 infection
    15039 (H2-T22)
   05168 Herpes simplex virus 1 infection
    15039 (H2-T22)
   05163 Human cytomegalovirus infection
    15039 (H2-T22)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15039 (H2-T22)
   05169 Epstein-Barr virus infection
    15039 (H2-T22)
   05165 Human papillomavirus infection
    15039 (H2-T22)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15039 (H2-T22)
   05330 Allograft rejection
    15039 (H2-T22)
   05332 Graft-versus-host disease
    15039 (H2-T22)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15039 (H2-T22)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15039 (H2-T22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15039 (H2-T22)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15039 (H2-T22)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15039 (H2-T22)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15039 (H2-T22)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 15039
NCBI-ProteinID: NP_001334311
MGI: 95956
Ensembl: ENSMUSG00000056116
Vega: OTTMUSG00000014954
UniProt: Q9BCZ1
Structure
PDB: 
1C16 1YPZ

Position
17 B1; 17 18.87 cM
AA seq 344 aa
MSWVLRAAVVCALLLQLDARPSWTRIPLGSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQ
VLRFSSKEETPRMAPWLEQEEADNWEQQTRIVTIQGQLSERNLMTLVHFYNKSMDDSHTL
QWLQGCDVEPDRHLCLWYNQLAYDSEDLPTLNENPSSCTVGNSTVPHISQDLKSHCSDLL
QKYLEKGKERLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLNGEELTQDM
ELVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLILRWGGRGRRDTQEAGRD
SPQDSSKTVVDDEEMGVCFWKIKSCKTCLGHSPGTSVGESLLSP
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtcctgggtcctcagggccgctgtggtctgcgcccttctcctgcagctggatgccaga
ccatcctggactcggatccctttgggttcacactcgcttaggtatttctacaccgctgtg
tcccggcctggccttggggagccctggttcataatcgtcggctatgtggacgacatgcag
gtcctgcgcttcagcagcaaggaggagactccgaggatggcaccctggctggagcaggag
gaagcagataactgggagcagcagactcgtatagtcacaattcaaggacagctgtctgaa
aggaatctgatgaccctggttcatttttacaacaagagcatggacgactctcacacacta
cagtggctgcaaggctgcgatgtggagccagatcggcacctgtgtctctggtacaaccag
ctcgcctatgatagcgaggatctccccaccctgaacgaaaacccaagttcctgtacagtg
ggaaacagcactgtacctcacatctctcaggacctgaagagccactgctcagatctgctg
cagaaatacctggaaaaagggaaggagaggctgctgcgttcagaccctccaaaggcacat
gtgacccgtcaccccagacctgaaggtgatgtcaccctgaggtgttgggccctgggcttc
taccctgctgacatcaccctgacctggcagttgaatggggaggagctgacccaggacatg
gagcttgtggagaccaggcctgcaggggatggaaccttccagaagtgggcagctgtggtg
gtgcctcttgggaaagagcagagttacacatgccatgtgtaccatgaggggctgcctgag
cccctcatcctgagatggggtgggagaggaaggcgtgacacccaagaagcaggcagagac
agtccccaagactctagcaagactgttgtggatgatgaggagatgggggtttgcttttgg
aagattaagtcctgtaaaacttgtctaggccactccccaggaacttcagttggcgagtct
ttactgtcaccttga

KEGG   Mus musculus (mouse): 15040
Entry
15040             CDS       T01002                                 

Gene name
H2-T23, 37b, 37c, H-2T23, H2-K1, H2-Qa1, Qa, Qa-, Qa-1, Qa-1(b), Qa1, Qed-1, T18c, T18c(37), T23b, T23d
Definition
(RefSeq) histocompatibility 2, T region locus 23
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15040 (H2-T23)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15040 (H2-T23)
   04145 Phagosome
    15040 (H2-T23)
  09143 Cell growth and death
   04218 Cellular senescence
    15040 (H2-T23)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15040 (H2-T23)
   04612 Antigen processing and presentation
    15040 (H2-T23)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15040 (H2-T23)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15040 (H2-T23)
   05170 Human immunodeficiency virus 1 infection
    15040 (H2-T23)
   05168 Herpes simplex virus 1 infection
    15040 (H2-T23)
   05163 Human cytomegalovirus infection
    15040 (H2-T23)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15040 (H2-T23)
   05169 Epstein-Barr virus infection
    15040 (H2-T23)
   05165 Human papillomavirus infection
    15040 (H2-T23)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15040 (H2-T23)
   05330 Allograft rejection
    15040 (H2-T23)
   05332 Graft-versus-host disease
    15040 (H2-T23)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15040 (H2-T23)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15040 (H2-T23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15040 (H2-T23)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15040 (H2-T23)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15040 (H2-T23)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15040 (H2-T23)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 Marek_A Psg1
Other DBs
NCBI-GeneID: 15040
NCBI-ProteinID: NP_034528
MGI: 95957
Ensembl: ENSMUSG00000067212
Vega: OTTMUSG00000014955
UniProt: P06339 Q3V014
Structure
PDB: 
3VJ6

Position
17 B1; 17 18.86 cM
AA seq 357 aa
MLLFAHLLQLLVSATVPTQSSPHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDA
ENPRMEPRARWIEQEGPEYWERETWKARDMGRNFRVNLRTLLGYYNQSNDESHTLQWMYG
CDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTANDIASQISKHKSEAVDEAHQQRAYL
QGPCVEWLHRYLRLGNETLQRSDPPKAHVTHHPRSEDEVTLRCWALGFYPADITLTWQLN
GEELTQDMELVETRPAGDGTFQKWAAVVVPLGKEQYYTCHVYHEGLPEPLTLRWEPPPST
VSNMVIIAVLVVLGAVIILGAVVAFVMKRRRHIGVKGCYAHVLGSKSFQTSDWPQKA
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgttgctttttgcccacttgcttcagctgctggtcagcgccacagtcccgacccagagt
agcccacactcgctgcggtatttcaccaccgccgtgtcccggcccggcctcggggagccc
cggttcatcattgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgacgcg
gaaaatccgaggatggagcctcgggcgcggtggattgagcaggaggggccggagtattgg
gagcgggagacttggaaagccagggacatggggaggaacttcagagtaaacctgaggacc
ctgctcggctactacaatcagagtaacgacgaatctcacacgctgcagtggatgtacggc
tgcgacgtggggcccgatgggcgcctgctccgcgggtattgtcaggaggcctacgatggc
caggattacatctccctgaacgaggacctgcgttcctggaccgcgaatgacatagcctca
cagatctctaagcacaagtcagaggcagtcgatgaggcccaccaacagagggcatacctg
caaggtccttgcgtggagtggctccatagatacctacggctgggaaatgagacactgcag
cgctcagaccctccaaaggcacatgtgacccatcaccctagatctgaagatgaagtcacc
ctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttgaat
ggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatggaacc
ttccagaagtgggcagctgtcgtggtgcctcttgggaaggagcagtattacacatgccat
gtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatccact
gtctccaacatggtaatcatagctgttctggttgtccttggagctgtgatcatccttgga
gctgtggtggcttttgtgatgaagaggaggagacacataggtgtaaaaggatgctatgct
catgttctaggcagcaagagcttccagacctctgactggcctcagaaggcatga

KEGG   Mus musculus (mouse): 15042
Entry
15042             CDS       T01002                                 

Gene name
H2-T24, H-2T24
Definition
(RefSeq) histocompatibility 2, T region locus 24
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15042 (H2-T24)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15042 (H2-T24)
   04145 Phagosome
    15042 (H2-T24)
  09143 Cell growth and death
   04218 Cellular senescence
    15042 (H2-T24)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15042 (H2-T24)
   04612 Antigen processing and presentation
    15042 (H2-T24)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15042 (H2-T24)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15042 (H2-T24)
   05170 Human immunodeficiency virus 1 infection
    15042 (H2-T24)
   05168 Herpes simplex virus 1 infection
    15042 (H2-T24)
   05163 Human cytomegalovirus infection
    15042 (H2-T24)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15042 (H2-T24)
   05169 Epstein-Barr virus infection
    15042 (H2-T24)
   05165 Human papillomavirus infection
    15042 (H2-T24)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15042 (H2-T24)
   05330 Allograft rejection
    15042 (H2-T24)
   05332 Graft-versus-host disease
    15042 (H2-T24)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15042 (H2-T24)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15042 (H2-T24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15042 (H2-T24)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15042 (H2-T24)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15042 (H2-T24)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15042 (H2-T24)
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 15042
NCBI-ProteinID: NP_032233
MGI: 95958
Ensembl: ENSMUSG00000053835
Vega: OTTMUSG00000014957
UniProt: F8VQG4
Position
17 B1; 17 18.84 cM
AA seq 363 aa
MWALIFWLLSHPQDGGARSHSLHYCYSAVTEPGPGVPSFFASGFLDNQPFIHYDSRSMKA
EPCADWLRENAQYFTHETEVFTNRMKIFQLSLRNIRQYYNSSGTQSQRADGFRQQAGPHT
LQFTYGCEMRYNRTTGHWQYGYDGSDYLTLDLGSMQYIAATFIAGYTKRKWENNEYWLEK
EKTYLEKECILWLQRYLTMGGKNFTRTDPPKTTVTHQFKPKENVTLRCWALGFYPADITL
TWQLNGEELTQDTELVETRPSGDGTFQKWAAVVVPSGEEQRYTCHVQHEALTQPLVLKWE
PLQLTTPTTGVYARGSCSPQATLLSVLAFPLFGIVLVFGLTRYKTQVRRKNWPAPSVPEE
ERL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtgggctcttatcttctggcttctgagtcacccccaggacggcggagcccggtcgcac
tctctgcattactgttactcagctgtgactgagccgggcccgggagttccttcatttttc
gccagtggcttcttagataaccagcccttcatccactacgacagcaggagcatgaaggca
gagccttgtgctgactggctgagggaaaatgcacagtacttcactcatgagactgaggtt
ttcaccaatcggatgaagattttccagttgagcctgagaaacattcggcaatactacaac
agctctggtacccagagtcagagagcagatggcttccgccagcaagcaggccctcacacc
ctccagttcacatacggctgtgagatgcggtacaacaggaccacagggcattggcagtat
ggctacgatggcagtgattacctgaccttggacttgggctctatgcaatatatagcagcc
accttcattgctggctacaccaagcgcaagtgggaaaacaatgagtactggctggagaaa
gagaagacctacttggagaaggagtgcatcctatggctgcagagatacttaaccatggga
ggaaagaactttacccgaactgaccctccaaagacaacagtgactcatcagttcaaacct
aaagaaaacgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctg
acctggcagttgaatggagaggagctgacccaggacacggagcttgtggagacgaggcct
tcaggggatgggacattccagaagtgggcagctgtggtggtgccttctggagaggagcag
agatacacatgtcatgtgcaacatgaggcactaacgcagccccttgttctgaaatgggag
cctcttcagctcaccacgcccacgacaggagtatatgctaggggaagctgtagtcctcaa
gcaaccttgctgagtgtccttgcgtttcctttatttggcatagtacttgtgtttggactt
acccgctacaaaactcaggtcagaagaaagaactggcctgctccatctgttcctgaagaa
gagaggctctag

KEGG   Mus musculus (mouse): 15043
Entry
15043             CDS       T01002                                 

Gene name
H2-T3, H-2T3, H2-Tw3, MumuTL, T, TL
Definition
(RefSeq) histocompatibility 2, T region locus 3
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15043 (H2-T3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15043 (H2-T3)
   04145 Phagosome
    15043 (H2-T3)
  09143 Cell growth and death
   04218 Cellular senescence
    15043 (H2-T3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15043 (H2-T3)
   04612 Antigen processing and presentation
    15043 (H2-T3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15043 (H2-T3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15043 (H2-T3)
   05170 Human immunodeficiency virus 1 infection
    15043 (H2-T3)
   05168 Herpes simplex virus 1 infection
    15043 (H2-T3)
   05163 Human cytomegalovirus infection
    15043 (H2-T3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15043 (H2-T3)
   05169 Epstein-Barr virus infection
    15043 (H2-T3)
   05165 Human papillomavirus infection
    15043 (H2-T3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15043 (H2-T3)
   05330 Allograft rejection
    15043 (H2-T3)
   05332 Graft-versus-host disease
    15043 (H2-T3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15043 (H2-T3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15043 (H2-T3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15043 (H2-T3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15043 (H2-T3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15043 (H2-T3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15043 (H2-T3)
SSDB
Motif
Pfam: MHC_I C1-set ig MHC_I_3 C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 15043
NCBI-ProteinID: NP_032234
MGI: 95959
Ensembl: ENSMUSG00000054128
Vega: OTTMUSG00000014949
UniProt: Q05A75 Q8HWB4
Position
17 B1; 17 18.99 cM
AA seq 384 aa
MRMGTMVPGTLLILLAASQGQTQTCPGSHSLRYFYTALSRPAISEPWYIAVGYLDDTQFV
RFNSSGETATYKLSAPWVEQEGPEYWARETEIVTSNAQFFRENLQTMLDYYNLSQNGSHT
IQVMYGCEVEFFGSLFRAYEQHGYDGRDYIALNEDLKTWTAADTAAEITRSKWEQAGYTE
LRRTYLEGPCKDSLLRYLENRKKTQECTDPPKTHVTHHPRPEGYVTLRCWALRFYPADIT
LTWQLNGEELIQDTELVETRPAGDGTFQKWAAVVVPLGKEQKYTCHVYHEGLPEPLTLRW
EPPQTSMPNRTTVRALLGAMIILGFMSGSVMMWMRKNNGGNGDDNTAAYQNEREHLSLSP
RAESEALGVEAGMKDLPSAPPLVS
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaggatggggaccatggtgcctggcaccctcctgatcctcctggctgcctcacaaggc
cagacccagacctgcccaggctcacactcgctgaggtacttctacaccgccttgtcccga
cctgcaatcagcgaaccgtggtacatagctgtgggctacctggatgacactcagttcgtg
cgcttcaacagctcaggggagactgcgacatataagctaagtgcgccatgggtggagcaa
gaggggcccgagtattgggcgagagagacagagatcgtcacaagcaatgcacagtttttc
cgcgagaatctgcagactatgctggactactacaacctgagtcaaaatggctctcacacc
atccaggtgatgtatggctgtgaggtggagttcttcgggagcctcttccgcgcttatgag
cagcatggctatgatggccgcgattacattgccctcaatgaagatctgaaaacgtggaca
gcagcagacacggcagcagagatcaccagaagcaagtgggagcaggctggttatacagag
ctccgtaggacctacttggagggcccatgcaaggattccctgctcagatacctggagaac
agaaaaaagacacaggagtgcacagatcctccaaaaacacacgtgacccatcaccccaga
cctgaaggttatgtcaccctgagatgctgggccctgcgcttctaccctgctgacatcacc
ctgacctggcagttgaatggggaggaattgattcaggacacggagcttgtggagaccagg
cctgcaggggatggaaccttccagaagtgggcagctgtggtggtgccgcttgggaaggag
cagaaatacacatgtcatgtgtaccatgaggggctgcctgagcctctcaccctgagatgg
gagcctcctcagaccagtatgcccaacaggaccactgttcgtgctctccttggagctatg
atcatcttaggttttatgagcggaagtgttatgatgtggatgagaaagaacaatggtgga
aacggagacgataacactgctgcatatcagaatgagagggaacacttgtccctgagccct
cgggctgaatctgaggcactcggggtggaagctgggatgaaggatcttccttctgcccca
ccattggtctcctga

KEGG   Mus musculus (mouse): 15051
Entry
15051             CDS       T01002                                 

Gene name
H2-T9, H-2T9
Definition
(RefSeq) histocompatibility 2, T region locus 9
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15051 (H2-T9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15051 (H2-T9)
   04145 Phagosome
    15051 (H2-T9)
  09143 Cell growth and death
   04218 Cellular senescence
    15051 (H2-T9)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15051 (H2-T9)
   04612 Antigen processing and presentation
    15051 (H2-T9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15051 (H2-T9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15051 (H2-T9)
   05170 Human immunodeficiency virus 1 infection
    15051 (H2-T9)
   05168 Herpes simplex virus 1 infection
    15051 (H2-T9)
   05163 Human cytomegalovirus infection
    15051 (H2-T9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15051 (H2-T9)
   05169 Epstein-Barr virus infection
    15051 (H2-T9)
   05165 Human papillomavirus infection
    15051 (H2-T9)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15051 (H2-T9)
   05330 Allograft rejection
    15051 (H2-T9)
   05332 Graft-versus-host disease
    15051 (H2-T9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15051 (H2-T9)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15051 (H2-T9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15051 (H2-T9)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15051 (H2-T9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15051 (H2-T9)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15051 (H2-T9)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 Mucin C2-set_2 GTF2I
Other DBs
NCBI-GeneID: 15051
NCBI-ProteinID: NP_034529
MGI: 95965
UniProt: Q31208
Position
17 B1; 17
AA seq 379 aa
MSWVLRAAVVCALLLQLDARPSWTRIPLGSHSLRYFYTAVSRPGLGEPWFIIVGYVDDMQ
VLLFSSKEETPRMAPWLEQEEAGDWEQQTRIVTIQGQLSERNLMTLVHFYNKSVDDSHTL
QWLQGCDVEPDRHLCLWYNQLAYDSEDLHTLNENPSSCTVGNSTVPHISQDLKSHCSDLL
QKYLEKGKERLLRSEPPKAHVTHHPRPAGDVTLRCWALGFYPADLTLTWQKDGEELTQDM
EFVETRPAGDGTFQKWAAVVVPLGKEQSYTCHVYHEGLPEPLTLRWEPAWYQKPWIWIVA
MVFILLIICLCVVCICMKKNAGGRGRRDTQEAGRDSPQDSSKTVVDDEEMGVCFWKIKYC
KTCLGHSPGTSVGESLLSP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtcctgggtcctcagggcggctgtggtctgcgcccttctcctgcagctggatgccaga
ccatcctggactcggatccctttgggttcacactcgcttaggtatttctacaccgctgtg
tcccggcctggccttggggagccctggttcataatcgtcggctatgtggacgacatgcag
gtcctgctcttcagcagcaaggaggagactccgaggatggcaccctggctggagcaggag
gaagcaggtgactgggagcagcagactcgtatagtcacaattcaaggacagctgtctgaa
aggaatctgatgaccctggttcatttttacaacaagagcgtggacgactctcacacacta
cagtggctgcaaggctgcgatgtggagccagatcggcacctgtgtctctggtacaaccag
ctcgcctatgatagcgaggatctccacaccctgaacgaaaacccaagttcctgtacagtg
ggaaacagcactgtacctcacatctctcaggacctgaagagccactgctcagatctgctg
cagaaatacctggaaaaagggaaggagaggctgctgcgttcagaacccccaaaggcacat
gtgacccatcaccccagacctgcaggtgatgtcaccctgaggtgctgggccctgggcttc
tatcctgctgacctcaccctgacctggcagaaggatggggaggagctgacccaggacatg
gagtttgtagagaccaggcctgcaggggatggaaccttccagaagtgggcagctgtggtg
gtgcctcttgggaaagagcagagttacacatgccatgtgtaccatgaggggctgcctgag
cccctcaccctgagatgggagcctgcatggtaccaaaagccttggatttggattgttgcc
atggttttcattttgctcatcatttgtctctgtgtggtttgcatatgcatgaagaagaat
gcaggtgggagaggaaggcgtgacacccaagaagcaggcagagacagtccccaagactct
agcaagactgttgtggatgatgaggagatgggggtttgcttttggaagattaagtactgt
aagacttgtctaggccactccccaggaacttcagttggcgagtctttactgtcaccttga

KEGG   Mus musculus (mouse): 224753
Entry
224753            CDS       T01002                                 

Gene name
H2-M10.4, 15H
Definition
(RefSeq) histocompatibility 2, M region locus 10.4
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    224753 (H2-M10.4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    224753 (H2-M10.4)
   04145 Phagosome
    224753 (H2-M10.4)
  09143 Cell growth and death
   04218 Cellular senescence
    224753 (H2-M10.4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    224753 (H2-M10.4)
   04612 Antigen processing and presentation
    224753 (H2-M10.4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    224753 (H2-M10.4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    224753 (H2-M10.4)
   05170 Human immunodeficiency virus 1 infection
    224753 (H2-M10.4)
   05168 Herpes simplex virus 1 infection
    224753 (H2-M10.4)
   05163 Human cytomegalovirus infection
    224753 (H2-M10.4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    224753 (H2-M10.4)
   05169 Epstein-Barr virus infection
    224753 (H2-M10.4)
   05165 Human papillomavirus infection
    224753 (H2-M10.4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    224753 (H2-M10.4)
   05330 Allograft rejection
    224753 (H2-M10.4)
   05332 Graft-versus-host disease
    224753 (H2-M10.4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    224753 (H2-M10.4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    224753 (H2-M10.4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    224753 (H2-M10.4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    224753 (H2-M10.4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   224753 (H2-M10.4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  224753 (H2-M10.4)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 224753
NCBI-ProteinID: NP_808302
MGI: 1276527
Ensembl: ENSMUSG00000048231
Vega: OTTMUSG00000014941
UniProt: Q85ZW8
Structure
PDB: 
1ZS8

Position
17 B1; 17 19.09 cM
AA seq 331 aa
MRNPGHFAILCLLLVTIDRPQYCEGSHWLKTFRIVIMEPGILEPRFIQVSYVDSIQYQGF
DSRSETAGMQPRAAWMKQEPPEYWKNETEHAMGASLLARRTLIYMVTENNNKKNDYHTLQ
EVFGCNVAHDGSFLGGHYGLTYYGYDYIILNEDLNSWTTEGKVGGKFNPDRTQGSVTEGW
RTYLKGECTERFLRCLDLGKETLLRSDAPRTHVTHKVTPEGNVTLRCWALGFYPADITLT
WKRDGKNHTQDMELPDTRPAGDGTFQKWAAVVVPFGEELRYTCHVHHEGLPGPLTLKWGP
PQTIPIIAILIGLVLVALVVGTVVIFLVWRK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaaccctggacactttgccatcctttgcctcctattggtgaccatagaccggccc
cagtattgtgaaggctcacactggctgaagactttcaggattgtaataatggagcctggc
atattggagccccggttcatccaggtcagctatgtagactccatacagtatcagggattc
gacagcagatcagagactgcggggatgcaacctcgggctgcttggatgaagcaggagcca
cctgaatattggaagaatgagacagaacatgccatgggcgcgtcactgttagcaagacga
actcttatatacatggtgactgaaaataataacaagaagaatgactatcacaccctgcag
gaagtgtttggctgcaatgtggcacatgatgggagcttccttggtggtcactacgggctc
acctactatggctatgattacatcatcctgaatgaggacctgaactcttggactacagag
ggaaaagtaggtggaaaatttaatccagaccggacgcaaggaagcgtgacagaaggttgg
aggacttacctgaaaggggagtgcacagaaaggtttcttagatgcctggaccttggaaag
gagaccttgctgcgctccgatgccccccgaacacatgtgacccacaaagtaacacctgaa
gggaatgtcaccctgaggtgctgggctctgggtttctacccagctgacatcaccctgacc
tggaagagagatgggaaaaaccacacccaggacatggagctgccagacaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggttccttttggagaagagctgaga
tacacatgtcatgtgcaccatgaagggttacctgggccactcactctgaaatgggggcct
ccacaaaccatccccatcatagcaattctcatcggcctggttcttgtagctttggtggtg
ggaactgtggtgatttttctggtgtggaggaaataa

KEGG   Mus musculus (mouse): 224754
Entry
224754            CDS       T01002                                 

Gene name
H2-M11
Definition
(RefSeq) histocompatibility 2, M region locus 11
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    224754 (H2-M11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    224754 (H2-M11)
   04145 Phagosome
    224754 (H2-M11)
  09143 Cell growth and death
   04218 Cellular senescence
    224754 (H2-M11)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    224754 (H2-M11)
   04612 Antigen processing and presentation
    224754 (H2-M11)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    224754 (H2-M11)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    224754 (H2-M11)
   05170 Human immunodeficiency virus 1 infection
    224754 (H2-M11)
   05168 Herpes simplex virus 1 infection
    224754 (H2-M11)
   05163 Human cytomegalovirus infection
    224754 (H2-M11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    224754 (H2-M11)
   05169 Epstein-Barr virus infection
    224754 (H2-M11)
   05165 Human papillomavirus infection
    224754 (H2-M11)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    224754 (H2-M11)
   05330 Allograft rejection
    224754 (H2-M11)
   05332 Graft-versus-host disease
    224754 (H2-M11)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    224754 (H2-M11)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    224754 (H2-M11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    224754 (H2-M11)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    224754 (H2-M11)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   224754 (H2-M11)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  224754 (H2-M11)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 224754
NCBI-ProteinID: NP_808303
MGI: 2676637
Ensembl: ENSMUSG00000037537
Vega: OTTMUSG00000037484
UniProt: Q85ZX0
Position
17; 17 B1
AA seq 336 aa
MKTFVTEALFLLLQVLLAMTSHPDGTHFFGFFQTLFTLPWMPKPQFISVGFVDDIQFERF
NSRRDVQRTEHCAPWKDQKKPEYWKDNTDLVLSYFQDLTEILQRMLKIYNYSLTGYHTIQ
RRYGCYILPRGYFRNGFFEVVFNDHDSIRLNEDLSTWTPVGKFAEILREEWDSSGFTQNV
KNFLEVECVDLFLTELEYGKEILLRTDIPKIHVIRKVRPDKKITLRCWALKFYPAEITLT
WERDKSNQTLDMEVTETMPTGDGTFQKWAAVVVLSGEEHRYKCHVNHEGLPEPITLRWVP
PEPTISFMHIVIVVVLGALLMGAMMTLLIWKRRTRG
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaagacctttgttaccgaggctctcttcctgctgctgcaggttctgttggccatgacc
agtcatccagatggtacccacttttttggctttttccaaactctcttcaccttgccctgg
atgcctaagccccaattcatcagtgttggttttgtggatgatatacagtttgagagattc
aacagcagaagagatgttcagaggacagagcactgtgcaccatggaaagatcaaaagaag
ccagagtattggaaggataacacagacctcgttctgagctattttcaggatttaacagag
atactgcaaaggatgctcaaaatctacaactacagtctaactggatatcacacaatccag
agaaggtatggctgctatatcctgcctcgagggtatttcagaaacggattctttgaagta
gtcttcaatgaccatgattccatcaggctgaatgaggacctaagcacttggaccccagtg
ggcaagtttgcagagattctcagagaagagtgggactcatcaggttttacacaaaatgtg
aagaatttcctggaggttgaatgtgtggacttattcctcacagagctggaatatggaaag
gagattttgctgagaacagatatccccaaaatacatgtgatccgtaaggtcagacctgat
aagaaaatcactctgaggtgctgggccttgaaattttaccctgctgaaatcaccctaacc
tgggaaagggacaaaagcaatcaaaccctggacatggaggtcacggagaccatgcctaca
ggggatggaaccttccagaagtgggcagctgttgtggtactttctggagaagaacataga
tataaatgtcatgtgaatcatgaggggctgcctgagcccatcaccctgagatgggtgcct
cctgagcccaccatttcctttatgcatattgttattgttgtggttcttggagctctgctt
atgggagctatgatgactttgctgatatggaagaggaggactagaggttaa

KEGG   Mus musculus (mouse): 224756
Entry
224756            CDS       T01002                                 

Gene name
H2-M1, H-2M1, H2-Qa-Mb1, Mb1
Definition
(RefSeq) histocompatibility 2, M region locus 1
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    224756 (H2-M1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    224756 (H2-M1)
   04145 Phagosome
    224756 (H2-M1)
  09143 Cell growth and death
   04218 Cellular senescence
    224756 (H2-M1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    224756 (H2-M1)
   04612 Antigen processing and presentation
    224756 (H2-M1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    224756 (H2-M1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    224756 (H2-M1)
   05170 Human immunodeficiency virus 1 infection
    224756 (H2-M1)
   05168 Herpes simplex virus 1 infection
    224756 (H2-M1)
   05163 Human cytomegalovirus infection
    224756 (H2-M1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    224756 (H2-M1)
   05169 Epstein-Barr virus infection
    224756 (H2-M1)
   05165 Human papillomavirus infection
    224756 (H2-M1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    224756 (H2-M1)
   05330 Allograft rejection
    224756 (H2-M1)
   05332 Graft-versus-host disease
    224756 (H2-M1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    224756 (H2-M1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    224756 (H2-M1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    224756 (H2-M1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    224756 (H2-M1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   224756 (H2-M1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  224756 (H2-M1)
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 C2-set_2 Psg1 LapA_dom
Other DBs
NCBI-GeneID: 224756
NCBI-ProteinID: NP_808304
MGI: 95913
Ensembl: ENSMUSG00000037334
Vega: OTTMUSG00000014938
UniProt: F7CXU4 Q85ZX2 Q31200
Position
17 B1; 17 19.16 cM
AA seq 344 aa
MKNFESQTLLLLLMITLAITKHPNGSHTLRYVYTLLSWPGPLEPQLIFLGYVDDTQIMGF
NSISENLGVESRAPWMYETEEFWEKTTDNVVREHYILKEIMRSVLHIYNYSIIGYHTIQK
TYGCQVMHRRYFSHGFFKLAFNLHDYITLNEDLKTWRGVGKAGEMLKEMWEKIKYANQVK
SFLQITCVNLLHRFLAFGKKSLLRTDTPKIHMTHKIRPDRKTTLRCWAFNFYPPEITLTW
QRDGSNQTQDMEMIETRPSGDGTFQKWAAVVVSTGEEHIYTCHVNHEGLSEPITIRWTKH
EPPEPTIPFLAIVIALVLGALLMGAVMTFLIWKRRTRGKKGSWS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaagaactttgaatcccagactctcctcctgctgctcatgatcaccttagccatcacg
aagcatccaaatggttcacacactctgagatatgtatataccctcctgtcatggcctggg
cctctggagccacagttaatctttctcggctatgtggatgatacacagatcatgggattc
aacagtatatcagagaatctgggggtggagagccgggcaccatggatgtatgagactgaa
gagttttgggaaaagacgacagataatgtcgtgagagaacactatatcttgaaagaaata
atgaggagtgtgctacacatctacaattatagcatcattggatatcacacaatccagaag
acttatggctgccaagtcatgcacagacgctacttcagtcatggcttctttaaattagca
ttcaatctccatgattacatcacactgaatgaggatctgaagacatggagaggagttggc
aaggcaggtgagatgcttaaggaaatgtgggagaaaataaaatatgcaaaccaggtgaag
tctttcctgcagattacatgtgtgaacttactccatcgattcctggcctttgggaagaag
agtttgctgagaacagacacccctaaaatacatatgacccataagatcagaccagatagg
aaaaccaccttgaggtgctgggccttcaacttctacccacctgaaattaccctaacctgg
cagagggatggaagcaaccagacccaggacatggagatgatagagaccaggccttctggt
gatggaactttccagaagtgggcagctgtggtggtctctactggagaagagcatatatac
acatgccacgtaaatcatgaggggctatctgagcccatcaccatcagatggacaaagcac
gagcctcctgagcccaccattcccttcttggctattgttattgctttggtacttggagca
ctccttatgggagcagtgatgacttttcttatatggaagagaaggactagaggtaagaaa
gggtcatggtcttaa

KEGG   Mus musculus (mouse): 224761
Entry
224761            CDS       T01002                                 

Gene name
H2-M10.5, 6.9H
Definition
(RefSeq) histocompatibility 2, M region locus 10.5
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    224761 (H2-M10.5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    224761 (H2-M10.5)
   04145 Phagosome
    224761 (H2-M10.5)
  09143 Cell growth and death
   04218 Cellular senescence
    224761 (H2-M10.5)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    224761 (H2-M10.5)
   04612 Antigen processing and presentation
    224761 (H2-M10.5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    224761 (H2-M10.5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    224761 (H2-M10.5)
   05170 Human immunodeficiency virus 1 infection
    224761 (H2-M10.5)
   05168 Herpes simplex virus 1 infection
    224761 (H2-M10.5)
   05163 Human cytomegalovirus infection
    224761 (H2-M10.5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    224761 (H2-M10.5)
   05169 Epstein-Barr virus infection
    224761 (H2-M10.5)
   05165 Human papillomavirus infection
    224761 (H2-M10.5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    224761 (H2-M10.5)
   05330 Allograft rejection
    224761 (H2-M10.5)
   05332 Graft-versus-host disease
    224761 (H2-M10.5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    224761 (H2-M10.5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    224761 (H2-M10.5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    224761 (H2-M10.5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    224761 (H2-M10.5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   224761 (H2-M10.5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  224761 (H2-M10.5)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 224761
NCBI-ProteinID: NP_808305
MGI: 1276526
Ensembl: ENSMUSG00000037246
Vega: OTTMUSG00000037372
UniProt: Q85ZW7 Q860W5
Position
17 B1; 17 19.16 cM
AA seq 330 aa
MRNPGCCTLLLLLVAMDLIQYCAGSHWLQTFNAVILEPGMVNSRFVHIGYVDSIEYQRYD
SKEPIAVLLPRVAWMEQVPMTYWTSETASVAELSQLDRRILHFMVNKNEQRMDDYHTLQE
VYGCNVANDGSFLGGHFRLTYYGYDDLYLNENLSSWIAHGNAAEYVKSRWDGEGDAERWK
TYLQGVCVERLLRYMVLGKEALLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITMTW
KRDGNNHTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHKGLPEPLKLKWEPP
HTIPIIAILIGLVLGTLVVGTVVIFLVWKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaaccctggatgctgcacactcctcctcctcttggtggccatggacctgatccag
tattgtgcaggctcacactggctgcagactttcaacgctgtgattttggagcctggcatg
gttaattcccggttcgtccacattggctatgtagactctatagagtatcagagatatgac
agcaaagaaccaattgcagttttgctacctcgggttgcatggatggagcaggtgccaatg
acatattggaccagtgagacagcaagcgttgcggaattgtcacagctagacagacgaatt
cttcacttcatggtgaacaaaaatgaacaaagaatggacgattatcacaccctgcaggaa
gtgtatggctgcaatgtggctaatgatgggagcttcctcggcggtcacttccggctcacc
tactatggctatgatgacttatacctgaatgagaacctgagctcctggattgcacatgga
aacgcagctgaatatgtgaagagcaggtgggacggtgaaggtgatgcagaaaggtggaag
acttacctgcaaggagtgtgcgtggaaaggcttcttagatacatggtccttggaaaggaa
gcattgctgcgctccgatgccccccgaacacatgtgacccaccatgtaagacctgaaggg
aatgtcaccctgaggtgctgggccctgggcttctacccagctgacataaccatgacttgg
aagagggatgggaacaaccacacccaagacatggagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttccttctggagaagagctgagatac
acatgtcatgtgcaccataaagggttacctgagcctctcaagctgaaatgggagcctcca
cacaccatccccatcatagcaattctcatcggcctggttcttggaactttggtggtggga
actgtggtcatttttctggtgtggaagaaataa

KEGG   Mus musculus (mouse): 240095
Entry
240095            CDS       T01002                                 

Gene name
H2-M5, CRW, CRW2, D130003B22Rik, H-2M5
Definition
(RefSeq) histocompatibility 2, M region locus 5
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    240095 (H2-M5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    240095 (H2-M5)
   04145 Phagosome
    240095 (H2-M5)
  09143 Cell growth and death
   04218 Cellular senescence
    240095 (H2-M5)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    240095 (H2-M5)
   04612 Antigen processing and presentation
    240095 (H2-M5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    240095 (H2-M5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    240095 (H2-M5)
   05170 Human immunodeficiency virus 1 infection
    240095 (H2-M5)
   05168 Herpes simplex virus 1 infection
    240095 (H2-M5)
   05163 Human cytomegalovirus infection
    240095 (H2-M5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    240095 (H2-M5)
   05169 Epstein-Barr virus infection
    240095 (H2-M5)
   05165 Human papillomavirus infection
    240095 (H2-M5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    240095 (H2-M5)
   05330 Allograft rejection
    240095 (H2-M5)
   05332 Graft-versus-host disease
    240095 (H2-M5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    240095 (H2-M5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    240095 (H2-M5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    240095 (H2-M5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    240095 (H2-M5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   240095 (H2-M5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  240095 (H2-M5)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 C2-set_2 Podoplanin
Other DBs
NCBI-GeneID: 240095
NCBI-ProteinID: NP_001108547
MGI: 95917
Ensembl: ENSMUSG00000024459
Vega: OTTMUSG00000014934
UniProt: A7VMS3
Position
17 B1; 17 19.16 cM
AA seq 348 aa
MRSPALSTLLSLLLTGALALTLVRAGIHSLQFFATTMTQPGLREHSFIFVVFVDDTQFLC
YNNKGKNQRMEPRALWVKQMGPEYWEQQTRTVKVIEKIALVNLQEAMDIYNHSKDGSHVF
QCVYGCEVGPDGLFLRGHEKHAYDGRDYLTLSPDLHSWVAGDTAAQITLRRWEKSGVSEQ
RQSFLKGECVESLRTYLEIGKETLLRTDPPKAHVTHHPRPEGEVTLRCWALGFYPANIIL
TWQWDEEDLTQDMDLIETRPAGDGTFQKWASVVVPSGEEQRYTCHVQHEGLTQPLVLKWD
PSKHTIPIMGITVGLLLFGVVFTGAVVAIVMRKRKGFQIIILKTFLKG
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagaagccctgcgctctctaccctcctatccttgctgctcaccggagctttggccttg
accctggttcgcgcaggcatccattccttgcagttttttgccaccaccatgacccagcct
ggtttgagggagcattccttcatctttgtcgtcttcgtggacgacacacagttcctgtgc
tacaacaataaggggaaaaatcagagaatggagccacgcgctctgtgggtgaagcagatg
gggccagagtattgggaacagcagaccaggactgtcaaggtcattgagaagattgcccta
gtgaatttgcaggaggccatggacatctacaaccacagcaaggatggctctcacgtcttt
cagtgtgtgtatggctgcgaagtggggccagatggactcttcctccgtgggcatgagaag
cacgcatacgacggccgcgattacctcaccctaagcccggacctgcactcctgggtcgca
ggcgacacagctgcgcagatcacgctgcgcaggtgggagaagtctggtgtctctgagcaa
aggcaatccttcttgaagggcgagtgtgtggagtcgctccgcacatacctggagataggg
aaggagactctgctaagaacagatcctcccaaggcacatgtgacccatcaccccagacct
gaaggtgaagtcaccctgaggtgctgggccctgggcttctaccctgctaacatcatcctg
acctggcagtgggatgaggaagacctgactcaggacatggacctcattgagaccagacct
gcaggggatgggaccttccagaagtgggcatctgtggtggtaccttctggagaggaacag
agatacacatgtcatgtgcaacatgaggggctaacccagccccttgttctaaaatgggac
ccttctaagcacaccattcccatcatgggaatcactgttggcctgcttctctttggagtt
gtgtttactggagctgtggttgccatagtgatgaggaagaggaaaggttttcagataata
attctaaaaacattcctgaagggctga

KEGG   Mus musculus (mouse): 333715
Entry
333715            CDS       T01002                                 

Gene name
H2-M10.2, 4.7H
Definition
(RefSeq) histocompatibility 2, M region locus 10.2
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    333715 (H2-M10.2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    333715 (H2-M10.2)
   04145 Phagosome
    333715 (H2-M10.2)
  09143 Cell growth and death
   04218 Cellular senescence
    333715 (H2-M10.2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    333715 (H2-M10.2)
   04612 Antigen processing and presentation
    333715 (H2-M10.2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    333715 (H2-M10.2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    333715 (H2-M10.2)
   05170 Human immunodeficiency virus 1 infection
    333715 (H2-M10.2)
   05168 Herpes simplex virus 1 infection
    333715 (H2-M10.2)
   05163 Human cytomegalovirus infection
    333715 (H2-M10.2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    333715 (H2-M10.2)
   05169 Epstein-Barr virus infection
    333715 (H2-M10.2)
   05165 Human papillomavirus infection
    333715 (H2-M10.2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    333715 (H2-M10.2)
   05330 Allograft rejection
    333715 (H2-M10.2)
   05332 Graft-versus-host disease
    333715 (H2-M10.2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    333715 (H2-M10.2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    333715 (H2-M10.2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    333715 (H2-M10.2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    333715 (H2-M10.2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   333715 (H2-M10.2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  333715 (H2-M10.2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 333715
NCBI-ProteinID: NP_808591
MGI: 1276525
Ensembl: ENSMUSG00000023083
Vega: OTTMUSG00000014948
UniProt: Q85ZW9
Position
17 B1; 17 19.01 cM
AA seq 329 aa
MNPGPCNFLLLLVALDLTQYCAGSHWLQTFNTVILKHGTLEPRIIQVGYVDSIQYQGFDS
KEPTARMQPRAAWMEQEPPEYWEKETAQVLRLSLTNERLLRYMMIYNEQSNEEYHTLQEV
FGCNVDNDGSFLGGLYRLTYYGYEFINLNEDLSSWTAQGEAAGFLKTDLVNVGAAEGWRT
YLLGECTERLLRCLDLGKETLLRSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITLTWK
RDGKNYTQDMELPDTRPAGDGTFQKWAAVVVPSGEELRYTCHVHHEGLPEPLTLKWEPPQ
TIPIIAILIGLVLGTFLVGTVVVFLVWKK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaaccctggaccctgcaacttcctcctcctcttggtggccttggacctgacccagtat
tgtgcaggctcacactggctgcagactttcaatactgtgattttgaagcatggcacgttg
gagccccggatcatccaggtcggctatgtagactccatacagtatcagggatttgacagc
aaagaaccgactgcaaggatgcaacctcgggctgcatggatggagcaggagccacctgaa
tattgggagaaggagacagcacaagtcctgcgcttgtcactgacaaacgaaagacttctt
aggtacatgatgatctacaatgaacagagcaatgaggaatatcacaccctgcaggaagtg
tttggctgcaatgtggataatgatgggagcttcctcggcggtctctaccggctcacctac
tacggctatgagttcatcaacctgaatgaggacctgagttcctggacagcacagggagag
gcagctgggttcctgaagacagacttggtgaatgtaggcgcagcggaaggctggaggacc
tacctgctaggggagtgcacagaaaggcttcttagatgcctggacctcggaaaggagacc
ttgctgcgctctgatgccccccgaacacatgtgacccaccatgtaagacctgaagggaat
gtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccctgacctggaag
agagatgggaaaaactacacccaggacatggagctgccagacaccaggcctgcaggggat
ggaaccttccagaagtgggcagctgtggtggttccctctggagaagagctgagatacaca
tgtcatgtgcaccatgaagggttacctgagcctctcactctaaaatgggagcctccacaa
accatccccatcatagcaattctcatcggcctggttcttggaactttcctggtaggaact
gtggtggtttttctggtgtggaagaaataa

KEGG   Mus musculus (mouse): 399549
Entry
399549            CDS       T01002                                 

Gene name
H2-M10.6
Definition
(RefSeq) histocompatibility 2, M region locus 10.6
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    399549 (H2-M10.6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    399549 (H2-M10.6)
   04145 Phagosome
    399549 (H2-M10.6)
  09143 Cell growth and death
   04218 Cellular senescence
    399549 (H2-M10.6)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    399549 (H2-M10.6)
   04612 Antigen processing and presentation
    399549 (H2-M10.6)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    399549 (H2-M10.6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    399549 (H2-M10.6)
   05170 Human immunodeficiency virus 1 infection
    399549 (H2-M10.6)
   05168 Herpes simplex virus 1 infection
    399549 (H2-M10.6)
   05163 Human cytomegalovirus infection
    399549 (H2-M10.6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    399549 (H2-M10.6)
   05169 Epstein-Barr virus infection
    399549 (H2-M10.6)
   05165 Human papillomavirus infection
    399549 (H2-M10.6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    399549 (H2-M10.6)
   05330 Allograft rejection
    399549 (H2-M10.6)
   05332 Graft-versus-host disease
    399549 (H2-M10.6)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    399549 (H2-M10.6)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    399549 (H2-M10.6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    399549 (H2-M10.6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    399549 (H2-M10.6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   399549 (H2-M10.6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  399549 (H2-M10.6)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 399549
NCBI-ProteinID: NP_963905
MGI: 2687364
Ensembl: ENSMUSG00000037130
Vega: OTTMUSG00000037373
UniProt: Q85ZW5
Position
17; 17 B1
AA seq 330 aa
MRKPGPWDLLLLLMAIDLTQYCAGSHWLQIFNIVILEPGMLEARFIQVGYVDSIQFQGFD
SKEPNARMQPRAAWMKQEPPEYWEKETAKALSFSLSGRRILKYMMSANKDKNNGYHTLQE
VYGCNVANDGSFLEGHYRLTYYGYDSLILNEDLNSWTAEGEVGEKFKTYQEQGGMTESWR
TYLLGECVERLLRCLDLGKKTLLHSDAPRTHVTHHVRPEGNVTLRCWALGFYPADITMTW
KRDGKNHTQDMELPDTRPAGDGTFQKWAAVVVPPGEELRYTCHVNHEGLPGPLTLKWEPP
HTIPIIAILIGLVLGALVVGTVVIFLVWKN
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaggaagcctggaccctgggacctcctcctcctgttgatggcaatagacctgacccag
tattgtgcaggctcacactggctgcagattttcaacattgtgattttggagcctggcatg
ttggaggcccggttcatccaggtcggatacgtagactccatacagtttcagggattcgac
agcaaagaaccaaatgcaaggatgcaacctcgggctgcttggatgaagcaggagccacct
gaatattgggagaaagagacagcaaaagccctgagcttctcactgtcaggaagacgaatt
cttaagtacatgatgtctgcaaataaagacaagaataatggttatcacaccctgcaggaa
gtgtatggctgcaacgtggcaaatgatgggagcttcctcgaaggtcactaccggctcaca
tactatggatatgattccttaatcctgaatgaggacctgaactcttggactgcagagggt
gaagtaggtgaaaaattcaagacataccaggagcaaggaggcatgacagaaagttggagg
acttacctgctaggggaatgcgtggaaaggcttcttagatgcctggaccttggaaagaag
accttgctgcactctgatgccccccgaacacatgtgacccaccatgtaagacctgaaggg
aatgtcaccctgaggtgctgggccctgggtttctacccagctgacatcaccatgacctgg
aagagggatggaaaaaaccacacccaggacatggagctgccagacaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggttcctcctggagaagagctgagatac
acatgtcatgtcaaccatgaagggttacctgggccactcactctgaaatgggagcctcca
cacaccatccccatcatagcaattctcatcggcctggttcttggagctttggtggtggga
actgtggtgatttttctggtatggaagaattaa

KEGG   Mus musculus (mouse): 547349
Entry
547349            CDS       T01002                                 

Gene name
H2-K1
Definition
(RefSeq) MHC class I family member
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    547349 (H2-K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    547349 (H2-K1)
   04145 Phagosome
    547349 (H2-K1)
  09143 Cell growth and death
   04218 Cellular senescence
    547349 (H2-K1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    547349 (H2-K1)
   04612 Antigen processing and presentation
    547349 (H2-K1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    547349 (H2-K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    547349 (H2-K1)
   05170 Human immunodeficiency virus 1 infection
    547349 (H2-K1)
   05168 Herpes simplex virus 1 infection
    547349 (H2-K1)
   05163 Human cytomegalovirus infection
    547349 (H2-K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    547349 (H2-K1)
   05169 Epstein-Barr virus infection
    547349 (H2-K1)
   05165 Human papillomavirus infection
    547349 (H2-K1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    547349 (H2-K1)
   05330 Allograft rejection
    547349 (H2-K1)
   05332 Graft-versus-host disease
    547349 (H2-K1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    547349 (H2-K1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    547349 (H2-K1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    547349 (H2-K1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    547349 (H2-K1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   547349 (H2-K1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  547349 (H2-K1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_C C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 547349
NCBI-ProteinID: NP_001020379
UniProt: Q4KN89
Position
17; 17 B1
AA seq 382 aa
MRLRRVFRVLVASLTLTETLAGSHSMRYFETAVSRPGLGEPRFISVGYVDDTQFVRFDGD
AENPRYEPWAPWMEQEGPEYWERETQIAKDNVQSFRGSLRNLLLYYNQSEGGSHTFQRLS
GCDLGSDGRLLRGYLQFAYEGQDYIALNEDLKTWTAADMAALITRRKWEQAGAAELYKAY
LEGECVEWLRRYLERGKETLLRTDPPKAHVTHHPRPEGDVTLRCWALGFYPADITLTWQL
NGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQKYTCHVHHEGLPEPLTLRWEPPPS
TVSNMIIIEVLIVLGAVINIGAMVAFVLKSKRKIGGKGGVYALAGGSNSIHGSALFLEAF
KAILPGPAGTRGHLHPDSSMLP
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaggctgcgaagggtgttccgggtgctggtggcctccctgaccctgaccgaaaccctc
gcgggctcacactcgatgcggtattttgagaccgccgtgtcccggcccggcctcggggag
ccccggttcatctctgtcggctacgtggacgacacgcagttcgtgcgcttcgacggcgac
gcggagaatccgagatatgagccgtgggcgccgtggatggagcaggaggggccggagtat
tgggagcgggagacacagatcgccaaggacaatgtgcagagtttccgagggagcctgagg
aacctgctcctctattacaaccagagcgagggtggctctcacacattccagcggttgtct
ggctgtgacttgggatcggacgggcgccttctccgcgggtacctgcagtttgcttacgaa
ggccaagattacatcgccctgaacgaagacctgaaaacgtggacagcggcggacatggca
gctctgatcacgcgacgaaagtgggagcaggctggtgctgcagagctatacaaggcctac
ctggagggcgagtgcgtggagtggctccgcagatacctggagcgcgggaaggagacgctg
ctgcgcacagatcccccaaaggcacatgtgacccaccaccccagacctgaaggtgatgtc
accctgagatgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaagtacacatgc
catgtgcaccatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
actgtctccaacatgataatcatagaagttctgattgtccttggagctgtgatcaacatt
ggagctatggtggcttttgtgttgaagagcaagagaaaaataggtggaaaaggaggggtc
tatgctctggctggaggcagcaacagtatccatggctctgccttgtttctggaggccttc
aaagccatccttcctggtccagcaggcactaggggacatctgcatcctgacagctccatg
ctgccctga

KEGG   Mus musculus (mouse): 630294
Entry
630294            CDS       T01002                                 

Gene name
Gm7030, EG630294, H2-t9
Definition
(RefSeq) predicted gene 7030
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    630294 (Gm7030)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    630294 (Gm7030)
   04145 Phagosome
    630294 (Gm7030)
  09143 Cell growth and death
   04218 Cellular senescence
    630294 (Gm7030)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    630294 (Gm7030)
   04612 Antigen processing and presentation
    630294 (Gm7030)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    630294 (Gm7030)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    630294 (Gm7030)
   05170 Human immunodeficiency virus 1 infection
    630294 (Gm7030)
   05168 Herpes simplex virus 1 infection
    630294 (Gm7030)
   05163 Human cytomegalovirus infection
    630294 (Gm7030)
   05167 Kaposi sarcoma-associated herpesvirus infection
    630294 (Gm7030)
   05169 Epstein-Barr virus infection
    630294 (Gm7030)
   05165 Human papillomavirus infection
    630294 (Gm7030)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    630294 (Gm7030)
   05330 Allograft rejection
    630294 (Gm7030)
   05332 Graft-versus-host disease
    630294 (Gm7030)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    630294 (Gm7030)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    630294 (Gm7030)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    630294 (Gm7030)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    630294 (Gm7030)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   630294 (Gm7030)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  630294 (Gm7030)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 630294
NCBI-ProteinID: NP_001170938
MGI: 3647514
Ensembl: ENSMUSG00000092243
Vega: OTTMUSG00000037034
UniProt: Q0WXH6
Position
17; 17 B1
AA seq 285 aa
MGTLTSCPLLLLLLATALAPTRAGKSSHSLRYFATAMSRPGLGEPRFTAVGYVDDTQFMR
FDSDSENPRAEPCKPWVEQMEPEYWEQETRKFKEHTQNFRTCLYNLLHLYNQSQDGPHTI
QDMHGCYVGPDGQFLHGHYQHAYDGHDYITLNEDLSSWTAADAVAQITQHKWEEAGVAEE
YKAYLEGTCVETLHRLLEEAQQHSDPPNTHVTRHPRPEGEVTLRCWALGFYPADITLTWQ
LNGEELTQDMELVETRPAGDGTFQKWAAVVVPFGEEPRYTCHVYH
NT seq 858 nt   +upstreamnt  +downstreamnt
atggggacccttacgagttgccctctacttctcctgctgctggcgaccgccctggccccg
acccgagcgggcaagagctcacactcgctgcggtatttcgccactgccatgtccaggcca
ggcttaggggagccccggttcaccgccgtgggttacgtggacgacacacagttcatgcgc
ttcgacagcgactctgagaatcccagggccgagccatgcaagccatgggtggaacagatg
gagcccgaatattgggagcaggagacgcggaaattcaaggagcacacccagaatttccga
acttgcctttacaacctactccacctgtacaaccagagtcaggacggtccccacactatc
caggatatgcacggatgctacgtgggaccagatggtcagttcctacacgggcactatcaa
catgcctatgatggccacgattacatcaccctgaacgaggacctgagctcctggaccgca
gcagatgcagtggctcagatcactcaacacaaatgggaggaggctggagtggcagaggaa
tacaaggcctacctagagggcacatgcgtggagacactccacagattgttggaggaagct
cagcaacactcagaccccccaaatacacatgtgacccgtcaccccagacctgaaggtgaa
gtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcag
ttgaatggggaggagctgacccaggacatggagcttgtggagaccaggcctgcaggggat
ggaaccttccagaagtgggcagctgtcgtggtgccttttggggaggagcctagatacaca
tgccatgtgtaccattag

KEGG   Mus musculus (mouse): 667803
Entry
667803            CDS       T01002                                 

Gene name
H2-T-ps, C920025E04Rik, H2-T11
Definition
(RefSeq) histocompatibility 2, T region locus, pseudogene
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    667803 (H2-T-ps)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    667803 (H2-T-ps)
   04145 Phagosome
    667803 (H2-T-ps)
  09143 Cell growth and death
   04218 Cellular senescence
    667803 (H2-T-ps)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    667803 (H2-T-ps)
   04612 Antigen processing and presentation
    667803 (H2-T-ps)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    667803 (H2-T-ps)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    667803 (H2-T-ps)
   05170 Human immunodeficiency virus 1 infection
    667803 (H2-T-ps)
   05168 Herpes simplex virus 1 infection
    667803 (H2-T-ps)
   05163 Human cytomegalovirus infection
    667803 (H2-T-ps)
   05167 Kaposi sarcoma-associated herpesvirus infection
    667803 (H2-T-ps)
   05169 Epstein-Barr virus infection
    667803 (H2-T-ps)
   05165 Human papillomavirus infection
    667803 (H2-T-ps)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    667803 (H2-T-ps)
   05330 Allograft rejection
    667803 (H2-T-ps)
   05332 Graft-versus-host disease
    667803 (H2-T-ps)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    667803 (H2-T-ps)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    667803 (H2-T-ps)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    667803 (H2-T-ps)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    667803 (H2-T-ps)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   667803 (H2-T-ps)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  667803 (H2-T-ps)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 Marek_A Psg1
Other DBs
NCBI-GeneID: 667803
NCBI-ProteinID: NP_001257934
MGI: 2442805
Ensembl: ENSMUSG00000073405
Position
17; 17 B1
AA seq 334 aa
MLLFAHLLQLLVSATVPTQSSSHSLRYFHTVVSRPGLGEPRFIIVGYVDDTQFVRFDSDS
ENPRMEPRARWIEQEGPEYWERETRKARDMGRNFRVNLRTLLGYYNQSKDESHTLQWMYG
CDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTATNLASHISKCKSEAVDEAHQQRAYL
QGPCVEWLHTYLQLGSETLLRSDPPKAHVTRHPRPEGDVTLRCWALGFYPADITLTWQLN
GEELTQDMEFVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEPPPST
VSNMVIIAVLVVLGAVIVIVAVVAFVMKRRKTQV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgttgctttttgcccacttgctccagctgctggtcagcgccacagtcccgacccagagt
agctcacactcgctgcggtatttccacaccgtcgtatcccggcccggcctcggagagccc
cggttcatcattgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgactcg
gagaatccgaggatggagcctcgggcgcggtggattgagcaggaggggccggagtattgg
gagcgggagactcggaaagccagggacatggggaggaacttcagagtaaacctgaggacc
ctgctcggctactacaatcagagtaaggacgaatctcacacgctgcagtggatgtacggc
tgcgacgtggggcccgatgggcgcctgctccgcgggtattgtcaggaggcctatgatggc
caggattacatctccctgaacgaagacctgcgctcctggaccgcgaccaacttagcctcg
catatctctaagtgcaagtcagaggcggtcgatgaggcccaccaacagagggcatacctg
caaggtccttgcgtggagtggctccatacatacctacagctgggaagtgagacactgctg
cgctcagaccctccaaaggcacatgtgacccgtcaccccagacctgaaggtgatgtcacc
ctgaggtgctgggccctgggcttctatcctgctgacatcaccctgacctggcagttgaat
ggggaggagctgacccaggacatggagtttgtggagaccaggcctgcaggggatggaacc
ttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacatgccat
gtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatccact
gtctccaacatggtaatcattgctgttctggttgtccttggagctgtgatagtcattgtt
gctgtggtggcttttgtaatgaagaggaggaaaacacaggtgtaa

KEGG   Mus musculus (mouse): 667977
Entry
667977            CDS       T01002                                 

Gene name
Gm8909, EG667977, H2-Tw5l, H2-gs17
Definition
(RefSeq) predicted gene 8909
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    667977 (Gm8909)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    667977 (Gm8909)
   04145 Phagosome
    667977 (Gm8909)
  09143 Cell growth and death
   04218 Cellular senescence
    667977 (Gm8909)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    667977 (Gm8909)
   04612 Antigen processing and presentation
    667977 (Gm8909)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    667977 (Gm8909)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    667977 (Gm8909)
   05170 Human immunodeficiency virus 1 infection
    667977 (Gm8909)
   05168 Herpes simplex virus 1 infection
    667977 (Gm8909)
   05163 Human cytomegalovirus infection
    667977 (Gm8909)
   05167 Kaposi sarcoma-associated herpesvirus infection
    667977 (Gm8909)
   05169 Epstein-Barr virus infection
    667977 (Gm8909)
   05165 Human papillomavirus infection
    667977 (Gm8909)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    667977 (Gm8909)
   05330 Allograft rejection
    667977 (Gm8909)
   05332 Graft-versus-host disease
    667977 (Gm8909)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    667977 (Gm8909)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    667977 (Gm8909)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    667977 (Gm8909)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    667977 (Gm8909)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   667977 (Gm8909)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  667977 (Gm8909)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C ig MHC_I_3 Ig_2 C2-set_2 LapA_dom Psg1 SP_C-Propep Marek_A
Other DBs
NCBI-GeneID: 667977
NCBI-ProteinID: NP_001074501
MGI: 3704134
Ensembl: ENSMUSG00000073402
Vega: OTTMUSG00000037026
UniProt: A7VMS6
Position
17 B1; 17
AA seq 368 aa
MAPRTLLLLLAAALILTETRAVSRPGPHSMRYFETAVSRPGLGEPWFISVGYVDDTQFVR
FDGDAENPRMEPRAPWMEQEGPEYWERETQIAKGHEQGFQGSLRNLLHYYNQSAGGSHTF
QRMYGCDLGSDGRLLRGYWQFAYDGSDYIALNQDLKTWTAADLAAQITRRRWEQGGVAET
LRAYLEDPCLEWLRRYLELGKETLLRTDPPKVHVTHHPRSEDDVTLRCWALGFYPADITL
TWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWE
PRPSRDSNMVIIAVLVVLGVVIIIGAMVPFVLKSRRKIGGKEENYALAGGSNSVQGSALF
LEAFSHPS
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcaccgcgaacgctgctcctgctgctggccgctgccctgatactgacggagacacgc
gcggtgtcccggcccggcccacactcgatgcggtatttcgagaccgccgtgtcccggccc
ggcctcggggagccctggttcatctctgtcggctacgtggacgacacgcagttcgtgcgc
ttcgacggcgacgcggagaatccgaggatggagccgcgggcgccctggatggagcaggag
gggccggagtattgggagcgggagacacagatcgccaagggccatgagcagggtttccaa
gggagcctgaggaacctgctccactactacaaccagagcgcgggcggctctcacacattt
cagaggatgtacggctgtgacctggggtcggacgggcgcctcctccgcgggtactggcag
ttcgcttacgacggcagcgattacatcgccctgaaccaagacctgaaaacgtggacggcg
gcggacttggcggcgcagatcactcgacgcaggtgggagcagggtggtgttgcagagacg
ctcagggcctacctggaggacccgtgcctggagtggctccgcagatacctggagctcggg
aaggagacgctgctgcgcacagatcccccaaaggtacatgtgacccatcatcccagatct
gaagatgatgtcaccctgaggtgctgggccctgggtttctaccctgctgacatcaccctg
acctggcagttgaatggggaggagctgacccaggacatggagcttgtggagaccaggcct
gcaggggatggaaccttccagaagtgggcatctgtggtggtgcctcttggaaaggagcag
aattacacatgccatgtgtaccatgaggggctgcctgagcccctcaccctgagatgggag
cctcgtccatccagggactccaacatggtaatcatagctgttctggttgtccttggagtt
gtgatcatcattggagctatggtgccttttgtgttgaagagcaggagaaaaataggtgga
aaagaagagaactatgctctggctggaggcagcaacagtgtccagggctctgccttgttt
ctggaggccttcagccatccttcctga

KEGG   Mus musculus (mouse): 69717
Entry
69717             CDS       T01002                                 

Gene name
Gm10499, MumuTL
Definition
(RefSeq) predicted gene 10499
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    69717 (Gm10499)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    69717 (Gm10499)
   04145 Phagosome
    69717 (Gm10499)
  09143 Cell growth and death
   04218 Cellular senescence
    69717 (Gm10499)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    69717 (Gm10499)
   04612 Antigen processing and presentation
    69717 (Gm10499)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    69717 (Gm10499)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    69717 (Gm10499)
   05170 Human immunodeficiency virus 1 infection
    69717 (Gm10499)
   05168 Herpes simplex virus 1 infection
    69717 (Gm10499)
   05163 Human cytomegalovirus infection
    69717 (Gm10499)
   05167 Kaposi sarcoma-associated herpesvirus infection
    69717 (Gm10499)
   05169 Epstein-Barr virus infection
    69717 (Gm10499)
   05165 Human papillomavirus infection
    69717 (Gm10499)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    69717 (Gm10499)
   05330 Allograft rejection
    69717 (Gm10499)
   05332 Graft-versus-host disease
    69717 (Gm10499)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    69717 (Gm10499)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    69717 (Gm10499)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    69717 (Gm10499)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    69717 (Gm10499)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   69717 (Gm10499)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  69717 (Gm10499)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 69717
NCBI-ProteinID: NP_001357747
MGI: 3702919
Position
17; 17 B1
AA seq 397 aa
MAQRMLLLLLAAALTLIETRAGSHSMRYFETALSRPGLREPRFISVGYVDDTQFVRFDGD
AENPRYEPRAPWMEHEGREYWERETQIAKRNEQSFRGSLRTAQRYYNQSEGGLHTFQLLF
GCDVGSDGRLLRGYLQFAYDGRDYIALNEDLNTWTAADLAALITRRKWEQAGAAEHYKAY
LEGECVESLRRYLQLGKETLLRTDPPKAHVTHHPRSEGDVTLRCWALGFYPADITLTWQL
NGEELTQDIELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVEHEGLPEHLTLRWEPPPS
TDSNMVEKEGTMLRLEEAKVARALTCFWGPSKLSFLVLQALGDICILTAPCCPELQLLTS
TLRIRIWRDGSAVKRTDCSFRGPEFIPSTHMVAHNHL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcgcagcgaatgctgctcctgctgctggcggccgccctgaccctgatcgagacccgc
gcgggctcacactcgatgcggtatttcgagaccgccttgtcccgccctggcctccgggaa
ccccgattcatctctgtcggctacgtggacgacacgcagttcgtgcgcttcgacggcgac
gcggagaatccgaggtatgagccgcgggctccatggatggagcacgaggggcgggagtat
tgggagcgggagacacagatcgccaagcgcaatgagcagagtttccgagggagcctgagg
accgcgcagcgctactacaaccagagtgaaggcggccttcacacgttccagctgttgttc
ggctgtgacgtggggtcggacgggcgcctcctccgcggatacctacagttcgcttatgat
ggccgagattacatcgccctgaacgaagacttgaacacgtggacggcggcggacctggca
gcgctgatcacccgacgcaagtgggagcaggctggtgctgcagagcattacaaggcctac
ctagagggcgagtgcgtggagtcgctccgcagatacctgcagctcgggaaggagacgctg
ctgcgcacagatcccccaaaagcccatgtgacccatcaccccagatctgaaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgacccaggacatagagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtggaacatgaggggctgcctgagcacctcaccctgagatgggagcctcctccatcc
acggactccaacatggtggaaaaggaggggactatgctccggctggaggaagcaaaggtg
gccagggctctgacttgtttctgggggccttcaaagctatccttcctggtcctgcaggca
ctaggggacatctgcatcctgacagctccatgctgccctgagctgcagctcctcacttcc
acactgagaataagaatctggagagatggctcagcagttaagagaactgactgctctttc
agaggtcctgagttcattccaagcactcacatggtagctcacaaccatctgtaa

DBGET integrated database retrieval system