KEGG   Mus musculus (mouse): 100535Help
Entry
100535            CDS       T01002                                 

Gene name
Oas1d, AA536864, C85127, oasl8
Definition
(RefSeq) 2'-5' oligoadenylate synthetase 1D
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C tRNA_NucTransf2 DUF3362
Motif
Other DBs
NCBI-GeneID: 100535
NCBI-ProteinID: NP_598654
MGI: 2140770
Ensembl: ENSMUSG00000032623
Vega: OTTMUSG00000025364
UniProt: Q8VI95 Q3UXA2
Position
5 F; 5 60.87 cM
AA seq 361 aa AA seqDB search
MARELFRTPIWRLDKFIEDQLLPDTTFLTELRADIDSISAFLMERCFQGAAHPVRVSRVV
MGGCYNEYTVLKGRSEANMVVFLINLTSFEDQFNGQVVFIEEIWRHLLQLQQEKLCKLKF
EVQSPKEPNSRFLSFKLSCPERQHELEFDVQPAYDALYEVRHFKPFDSSNYNKVYAQLTH
ECTTLEKEGEFSICFTDLHQSFLRYRAPKLWNLIRLVKHWYQLCKEKLRGPLPPQYALEL
LTVYVWEYGIHENPGLHTAQCFRTVLELVTKYKRLRIYWTWCYDFQHEISDYLQGQIKKA
RPLILDPADPTRNVAGSDLQAWDLLAKEAQIWIDSTFFTNHDMSIVEAWEVMPERQECVF
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggaactcttcagaaccccaatctggaggctggataagttcatagaggatcaa
ctccttcctgacaccaccttccttactgagctcagagcagacatcgactccataagtgct
ttcctgatggagagatgcttccaaggtgccgcccatcctgtgagggtctccagggttgtg
atgggtggctgctacaatgaatacactgtgctcaagggcaggtctgaggccaacatggtg
gtgttccttatcaatctcacaagctttgaggatcagttcaacggacaggtagtgttcatt
gaggaaatttggagacacctactccagttgcagcaagagaaactatgtaaactcaagttt
gaggtccagagcccaaaggagcccaactccaggtttctgagcttcaagctgagctgcccc
gagcgccagcatgagttggaatttgatgtgcagccagcctatgatgccctgtatgaagta
agacacttcaagccctttgactccagtaactacaacaaagtctacgcccaactcacccat
gagtgcaccacactggagaaggagggcgagttctccatctgcttcaccgacctccatcag
agcttcctgaggtatcgtgcgcccaagctctggaacctcatccgtttggtcaagcactgg
tatcaactgtgtaaggagaagctgagggggccgctgcctccacagtacgccctggagctg
ctcacagtctacgtctgggaatacgggatccacgaaaaccctggactccatacagcccag
tgcttccgcactgtcttagaacttgtcaccaagtacaaacggcttcgaatctactggaca
tggtgttatgactttcaacacgagatctctgactacctgcagggacagatcaaaaaagcc
aggcctctgatcctggatccagcagacccaacaaggaatgtggctggttcagacttacag
gcatgggacctgctggcaaaggaggctcagatctggatagattcgactttctttacgaac
catgatatgtccattgtggaagcctgggaagtgatgccagagagacaagaatgtgtcttc
ctgtga

DBGET integrated database retrieval system