KEGG   Mus musculus (house mouse): 100554
Entry
100554            CDS       T01002                                 
Name
(RefSeq) expressed sequence AA792892
Organism
mmu  Mus musculus (house mouse)
SSDB
Other DBs
NCBI-GeneID: 100554
NCBI-ProteinID: NP_849225
MGI: 2140789
Ensembl: ENSMUSG00000073497
UniProt: Q8C6S1
Position
5:94525199..94532193
AA seq 278 aa
MSGQTPPTRTLLTHEALIKSSLEELPTVVFPALFKEVFAGRHTNLLKAMVAAWPFPCLPV
GPLIKKPNLETLQALLDGVDMRLTREFHPRCLMTPFETFSITQCLISQRDFDFFSCSHNL
FKLKHLEIRGMILYALDLMPLRGLLQKVADTLEFLDFQWCRMKDSQINALLPALSQCTHL
NQINFYNNDFSMSTLKELLQHTANWSKMNVEQCPAPLQCYNELGHVSVERFVQLCQELMY
TLRAIRQPKSISFATDSCHKCCKPCVYDQDPILCSCFQ
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagtggtcagaccccacccacacgcactctgctgacacatgaagctttgatcaagtcc
tctctggaggagttgcctactgtggtcttcccagcactattcaaagaggtctttgctggc
agacacaccaatctcctaaaggcaatggtggcagcctggcctttcccctgtctccctgtg
ggaccattgataaagaagcctaacctagaaaccttgcaagctctgctagatggagtagac
atgagactgacaagagagtttcaccccaggtgcctgatgactcccttcgagaccttctcc
atcacccaatgcctaatttcacagagagactttgatttcttttcttgctcccacaacctc
tttaaattaaaacatctggaaataagagggatgatcttatatgctttggatcttatgcct
ctgagaggtctcctacaaaaagtagcagacactcttgagtttctggattttcagtggtgt
aggatgaaggactcccagatcaatgccctcctacctgccctcagtcaatgcactcacctc
aaccagatcaacttctacaacaatgacttctccatgtccaccctgaaggagcttttacag
cacacagccaactggagcaagatgaatgtggaacaatgccctgcccctctgcagtgctat
aatgagttgggtcatgtctctgtagaaagatttgtccaactttgtcaggagctcatgtat
actctcagagctataaggcagcccaagagcatctcttttgctacagatagctgtcacaaa
tgttgtaagccctgtgtctatgaccaggaccctatactttgttcttgttttcagtaa

DBGET integrated database retrieval system