KEGG   Mus musculus (house mouse): 100561
Entry
100561            CDS       T01002                                 
Symbol
Slc15a4, AA987064, AW742963, C130069N12Rik, PHT1, PTR4
Name
(RefSeq) solute carrier family 15, member 4
  KO
K14638  solute carrier family 15 (peptide/histidine transporter), member 3/4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    100561 (Slc15a4)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   100561 (Slc15a4)
SSDB
Motif
Pfam: PTR2 MFS_1 MFS_1_like
Other DBs
NCBI-GeneID: 100561
NCBI-ProteinID: NP_598656
MGI: 2140796
Ensembl: ENSMUSG00000029416
UniProt: Q91W98
Position
5:complement(127668795..127710356)
AA seq 574 aa
MEGERAPLLGSRRPAVSAASAVFAGRRAACGAVLLAELLERAAFYGVTANLVLFLNGAPF
DWEGAQASQALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGLLAFPLLAAPR
SRSFLCGDPRPELVRNCSAPFPNGSASCPENAARRCAPATFAGLVLVGLGVATVKANITP
FGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFFTGYLIPTVCVAIAF
LVFLCGQSVFITKPPDGSAFTDMFRILTYSCCSQRGGQRRSGEGLGVFQQSSKHSLFDSC
KMSRGGPFTEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYALQSLHLKIPEISSITT
THHTLPAAWLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVMCSAFAA
GILESKRLDLVKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSA
APKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGNINSCHLHYYFFLL
AAIQGATLLLFLIVSVKYDRQRARTDGGPASTRT
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggagggcgagcgggcgccgctgttgggttcgcggcgtccggcagtgtcggcggcgtcc
gcggtgttcgcggggcggcgtgcggcgtgcggggcggtgctgttggccgagctgctggag
cgcgcggccttctacggcgtcacggccaacctggtgctgttcctgaatggcgcgccgttc
gactgggagggcgcgcaggccagccaggcgctgctgctcttcatgggcctcacctatctg
ggctcgccgttcgggggctggctcgccgacgcccgcctcggccgggcccgcgccatcctg
ctcagcctggccctctacctgctgggcctgctggccttcccgctgctggccgcgccccgc
tcgcgctccttcctctgcggggacccgcggcccgagctcgtgcgcaactgctcggcgccc
ttccccaacgggtcagcgtcgtgtcccgagaacgccgcgcgccgctgtgcccccgccacc
ttcgcggggctcgtgctcgtgggtctcggggtggccacggtcaaggccaacatcacgccc
ttcggcgccgatcaggttaaagatcgaggtccagaagccactcggagatttttcaattgg
ttttactggagcattaatttgggagcaatcctgtcattaggaggtattgcctatattcag
cagaatgtgagctttttcacaggctacctgattcccacagtctgtgtggccattgctttc
ctggtcttcctctgtggccagagtgtcttcatcaccaagcctcctgacggcagtgccttc
actgacatgttcagaattctgacctacagttgctgctcccagagaggagggcagcggaga
agtggtgaaggccttggagtctttcagcaatcttctaaacacagtctgtttgattcatgt
aagatgtcgcgtggagggccgttcacagaggacaaagtggaagacgtgaaagccctggtc
aagattgtgcccgtgttcttggctctgattccttactggacagtgtatttccaaatgcag
accacatatgctttacagagtcttcatttgaagattccagaaatctcaagtatcaccacc
acccatcacacgctgcctgcagcttggctcaccatgtttgatgcggtgctcatcctcctg
ctcatcccactgaaggacaagctggtggacccggtgctgaggagacatggcctgctccca
tcctccctgaagaggattgctgtggggatgttcttcgtcatgtgctctgcctttgctgca
ggaatcctggagagtaaaaggctggacctggtaaaggagaagaccattaaccagaccatt
ggtggtgtggtgtaccatgctgctgacttgcccatctggtggcagatcccacagtatgtg
ctcattggcatcagtgagatatttgcaagtatagcaggtctggaatttgcatactcagct
gcccccaagtccatgcagagcgccatcatgggactcttcttcttcttctctggcattggg
tcctttgtgggctcaggactgttggccctggtgtctctcaaggccattgggtggatgagc
agtcatacagattttgggaacatcaacagctgccacctgcattactacttcttcctgctg
gccgccatccagggagctacgctgctgctcttcctcattgtgtctgtgaagtacgaccgc
cagcgagccaggacagatggggggccagccagcacgaggacctga

DBGET integrated database retrieval system