KEGG   Mus musculus (house mouse): 100683
Entry
100683            CDS       T01002                                 
Symbol
Trrap
Name
(RefSeq) transformation/transcription domain-associated protein
  KO
K08874  transformation/transcription domain-associated protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03082  ATP-dependent chromatin remodeling
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09126 Chromosome
   03082 ATP-dependent chromatin remodeling
    100683 (Trrap)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100683 (Trrap)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    100683 (Trrap)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    100683 (Trrap)
   03036 Chromosome and associated proteins [BR:mmu03036]
    100683 (Trrap)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100683 (Trrap)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100683 (Trrap)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     100683 (Trrap)
    STAGA complex
     100683 (Trrap)
    TFTC complex
     100683 (Trrap)
    TIP60 complex
     100683 (Trrap)
    SAGA complex
     100683 (Trrap)
    SLIK complex
     100683 (Trrap)
    NuA4 complex
     100683 (Trrap)
  Chromatin remodeling factors
   ASTRA complex
    100683 (Trrap)
SSDB
Motif
Pfam: Tra1_ring Tra1_central FAT PI3_PI4_kinase FATC DEC-1_N BALF1
Other DBs
NCBI-GeneID: 100683
NCBI-ProteinID: NP_001074831
MGI: 2153272
Ensembl: ENSMUSG00000045482
UniProt: E9QLK7
Position
5:144704547..144796588
AA seq 3847 aa
MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYST
FLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEILHRIPTNEHLRPHTKNVLSVMFRF
LETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQGIP
ENTVPPPEMVGMITTVAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYK
LNIHNVVAEFVPLIMNTIAIQVSTQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE
LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESIL
IGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC
KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAA
EAALPGVPTAPAAPGPAPSPAPVPAPAPPPPPPPAPATPVTPAPVPPFEKQGEKDKEDKQ
TFQVTDCRSLVKTLVCGVKTITWGITSCKAPGAQFIPNKQLQPKETQIYIKLVKYAMQAL
DIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVE
RISKNYALQIVANSFLANPTTSALFATILVEYLLERLPEMGSNVELSNLYLKLFKLVFGS
VSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFL
PLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQT
LVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGG
SNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYR
RQAWEVIRCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQ
ALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSE
ENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSY
IVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSN
GAVAMAKTTLEQLLMRCATPLKDEERAEEIVLAQEKSFHHVTHDLVREVTSPNSTVRKQA
MHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQP
RLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLP
QSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSL
TLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNEMKICSAII
NLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIKFLTRHPSQTVELFMMEAT
LNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGGAQTAVRPGSPSTSNMRLDL
QFQAIKIISIIVKNDDAWLASQHSLVSQLRRVWVSETFQERHRKENMAATNWKEPKLLAF
CLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEIPKNYSIAQKRALFFRFVE
FNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNPEGDNPESITSVFITKVLDP
EKQADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLRRLMTFAWPCLLSKACVDPA
CKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIVRQAMAILTPAVPARMEDG
HQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHHLVQHMVSAMQRLGFTPSV
TIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVNSVSIKRGLSVDSAQEVKR
FRAATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNFLIRVACQVNDNTNTAGSPGE
VLSRRCVNLLKTALRPDMWCKSELKLQWFDKLLMTVEQPNQVNYGNICTGLEVLNFLLTV
LQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRLMSIFPTEPSTSSVASKYEELE
CLYAAVGKVIYEGLTNYEKATSANPSQLFGTLMILKSACCNNPSYIDRLISVFMRSLQKM
VREHLNPQTASGSTEATAAGTSELVMLSLDLVKTRLAVMSMEMRKNFIQTILTSLIEKSP
DAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILLVKMMTYIEKRFPEDLELNAQFLD
LVNYVYRDEALSGSELTAKLEPAFLSGLRCAQPLIRAKFFEVFDNSMKRRVYERLLYVTC
SQNWEAMGSHFWIKQCIELLLAVCEKSTAIGTSCQGAMLPSITNVINLADSHDRAAFAMV
THVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELSEKDIGNQLHMLTNRHDKFL
DTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKILSDRQQHALAGEISPFLCSG
SHQVQRDCQPSALNCFVEAMSQCVPPIPMRPCVLKYLGKTHNLWFRSTLMLEHQAFEKGL
SLPIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDMWAGLWQKRCKFSETATAIA
YEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEYQLWEDHWIRCSKELNQWEALTE
FGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEMAWKVNMYRGYLAICHPEEQ
QLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQIIELQEAAQINAGLQPTNLG
RNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSVFMWRQHHYQAIVTAYENSSHHDPSSNNA
MLGVHASASAIIQYGKIARKQGLVNVALDILSRIHTIPTVPIVDCFQKIRQQVKCYLQLA
GVMGKNECMQGLEVIESTNLKYFTKEMTAEFYALKGMFLAQINKSEEANKAFSAAVQMHD
VLVKAWAMWGDYLESIFVKERQLHLGVSAITCYLHACRHQNESKSRKYLAKVLWLLSFDD
DKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGSEGKLLLNLISQVGRVYPQAVYFPIR
TLYLTLKIEQRERYKSDSGQQQPSSAGNQSHSASDPGPIRATAPMWRCSRIMHMQRELHP
TLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSDAKITPHTLNFVK
KLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQFTTDFDFSVPGSM
KLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEIPGEFLMPKPTHY
YIKIARFMPRVEIVQKHNTAARRLHIRGHNGKIYPYLVMNDACLTESRREERVLQLLRLL
NPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVEDNPSSLSLVEIYKQRCAKKGIEHDNPI
SRYYDRLATVQARGTQASHQVLRDILKEVQSNMVPRSMLKEWALHTFPNATDYWTFRKMF
TIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGDLDANRPVPFRLT
PNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGVLKTVLRDEIIAWHKKTQEDTSSP
LSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFDGGESKVNTLVAAANSLDNLCRMD
PAWHPWL
NT seq 11544 nt   +upstreamnt  +downstreamnt
atggcgttcgttgcaacccagggggccacggtggtcgaccaaaccactctgatgaagaaa
taccttcagtttgtggcagctctcacggatgtgaatacacctgatgaaacgaagttgaaa
atgatgcaggaagtcagcgagaactttgagaatgtcacgtcatctcctcagtattctaca
ttcctggaacacatcatccctcgatttcttacctttctccaagatggagaagtccagttt
cttcaggagaagccagcccagcaactacggaagctggtacttgagatactccacaggatt
ccaaccaatgagcatctgcgtcctcatacgaaaaacgttctgtctgtcatgtttcggttt
ttagagacggaaaatgaagaaaatgttcttatttgtctaagaataattattgagctgcac
aaacagttcaggccaccgatcacgcaagagattcatcactttttggattttgtgaaacag
atttacaaggagcttccaaaagtagtgaaccgctactttgagaacccccaggggatccct
gagaacacagtgcctccccctgaaatggtgggcatgatcacgactgttgctgtgaaggtc
aatcctgagcgcgaggacagcgagacacggacgcattccatcatcccacgaggatcgctc
tcactgaaagtcctggccgagctccccatcattgtcgtactgatgtaccagctgtacaaa
ctgaacatccacaacgttgttgccgagtttgtgcccctgatcatgaataccattgcaatt
caggtatccacacaggccaggcaacataagctttacaacaaggagctgtatgctgacttc
attgcagctcagatcaaaacgctgtcgtttttagcctacatcatcaggatttaccaggag
ctggtgacgaagtattctcagcagatggtgaaaggcatgctacagctgctttccaattgc
ccagcggagactgcgcacctcaggaaggagctgctcattgcggccaagcacatcctcacc
acggagctgaggaaccagttcatcccctgcatggacaagctgtttgatgaatccatcctg
atcggctctgggtacaccgctcgggagacactcaggcccctcgcctacagcacacttgcc
gaccttgtgcatcacgttcgccagcacctgcccctcagcgacctctccctcgccgtccag
ctctttgccaagaacatcgatgatgagtccctgcccagtagcatccaaaccatgtcctgc
aaactcctactgaacctggtggactgcatccgctccaagagtgagcaggagagtggcaat
ggcagagatgtcctgatgcggatgctggaggtttttgtcctcaagttccacaccattgcc
cggtaccagctctctgccatttttaagaaatgcaagcctcagtctgaactgggggctgca
gaagctgcactacctggggtgcccacagcccctgctgcccctggcccagccccttcccca
gcccctgtgcctgcccccgcaccacctccacctccacctccagccccagccaccccggta
acccctgcccccgtgcccccatttgagaagcaaggagagaaggacaaggaggacaagcag
acgttccaggtcacagattgccggagtctggtgaagaccttggtctgcggtgtcaagacc
atcacatggggcataacgtcgtgtaaagcacctggtgctcagtttattcctaacaagcaa
ttacaacccaaagaaactcagatttacatcaagctggtgaagtatgcgatgcaggccttg
gatatttatcaggtccagatcgcaggaaatggacaaacatacattcgagtagccaactgt
cagaccgtaaggatgaaggaagagaaggaggtgctggagcactttgctggggtcttcacc
atgatgaacccactaacattcaaggagatcttccagactacagttccttacatggtagaa
aggatctcaaaaaactatgctcttcagattgttgccaactccttcttggcgaatcccact
acctctgctctgtttgccaccatcctggtggagtacctcctggagcggctgccggaaatg
ggctccaacgtggagctctccaacttgtacctcaagctcttcaagttggtcttcggctca
gtgtcgctgtttgcagcggagaatgagcagatgctgaagcctcacctgcacaagatcgtg
aacagctccatggagttggcgcaaaccgccaaggagccttacaactacttccttctgctc
cgtgctctcttccgctctataggaggtggcagccatgacctcctgtatcaggagtttctg
cctctccttccaaatctcctccaaggactgaacatgctgcagagcggcctgcataagcag
cacatgaaggacctctttgtagagctgtgtctcaccgtgccagtccggctgagctctctc
ctgccctatctgcccatgttgatggatcccttggtgtctgccctcaatgggtctcagaca
ttggtcagccaaggcctgaggaccttggagttgtgtgtggacaacctgcagccggatttc
ctctatgaccacattcagcctgtgcgtgcagagctcatgcaggctttgtggcgcacgctt
cgcaaccctgcagacagcatctcccacgtggcctaccgtgtgcttgggaagtttggcggc
agcaacaggaagatgttgaaggagtcccagaagctgcactatgttgtgactgaagttcaa
ggccccagcattaccgtggagttctctgattgcaaagcttctctccagcttccgatggaa
aaggccattgagaccgccctggactgcctgaaaagtgccaacacagagccctactaccgg
aggcaggcatgggaggtgatcaggtgcttcctggtagccatgatgagcctggaggacaac
aagcatgcgctctaccagctgctggcgcaccccaactttacagaaaagaccattcccaat
gtcatcatatcacatcgctacaaagcacaggacactccagcccggaaaacatttgaacag
gctctgactggggcattcatgtctgcagtcatcaaagacctgcgacccagtgccctgccc
tttgtggccagcttgatccgccactacaccatggtagcagtggcccagcagtgtggtcct
ttcttgctaccttgctaccaggtgggtagccagcccagcacagccatgttccacagtgaa
gaaaatgggtccaaaggaatggatcccttggtccttattgatgccatagctatctgtatg
gcttatgaagaaaaggaactgtgcaagattggggaggtagccctggccgtgatatttgac
gtggcgagcatcatcctgggctcaaaagagagggcatgccagctgcccctcttctcctac
attgtggagcggttgtgcgcctgctgctatgagcaggcctggtatgcaaagctggggggc
gtggtgtccattaagtttctcatggagcggctcccactcacgtgggttctccagaaccag
cagacattcctcaaagctctgctctttgtaatgatggacctgactggagaggtttccaat
ggggcagtggccatggcgaagaccaccctggaacagctcctgatgagatgtgcgacccct
ttgaaggatgaggagagagctgaggagattgtgctggctcaagagaaatcttttcaccac
gtgacccacgatttggttcgtgaagtcacctccccaaactcgactgtgagaaagcaggcc
atgcattcgctgcaggtcttggcccaggtcactggaaaaagtgtgacagtaattatggag
ccacataaggaggtccttcaggatatggtcccaccgaagaagcacctgctgcgacaccag
cctgccaacgcccagatcggactgatggagggcaatacgttctgtaccacgctgcagcct
cgactcttcacgatggatctcaatgtggtggagcacaaggtcttctacacagagctgctg
aatttgtgtgaggctgaggactccgctctgaccaagctgccctgttacaaaagcctccca
tcgcttgtgcccttacggatcgcagcattgaatgctctcgctgcctgcaattacctacct
cagtccagggagaaaatcattgctgctcttttcaaagccctcaactccaccaacagtgag
ctgcaggaggctggggaagcctgcatgaggaagtttttggaaggtgccaccatagaagta
gatcagattcatacgcacatgcggcccttgctgatgatgctgggagactaccggagcttg
accctgaacgtcgtgaaccggctcacctccgttactcgcctcttcccaaattccttcaat
gataagttttgtgaccagatgatgcaacatctgcgcaagtggatggaagtggtggtcatc
acccacaaagggggccagaggagtgacggaaacgaaatgaagatttgctcggcaattata
aaccttttccatctgatcccagccgctcctcagacgctggtcaagcctctgttggaggtt
gtgatgaagacagagcgggccatgctgattgaggcgggcagtccattcagagagccactt
atcaagttcctgacccggcatccctcgcagacagtggagttgttcatgatggaagcaaca
ctgaatgatccccagtggagccgaatgttcatgagtttcttaaaacacaaagatgccaga
cctctgagggatgtgttggcagcaaaccccaacaggttcatcactctgctgctgcctggt
ggtgcacagaccgcagtccgccccggctcacccagtaccagtaacatgcgcctggacctc
cagttccaggccatcaagatcataagcatcatagttaaaaatgatgatgcctggctggcc
agtcagcactctctggtgagccagttgaggcgagtgtgggtgagtgagacctttcaagaa
agacaccgcaaagagaacatggctgccaccaactggaaggagcccaagcttctggccttc
tgtctgctgaactattgcaaaaggaactatggcgacatagagctgctgttccagctgctc
cgagccttcactggtcgtttcctgtgcaacatgaccttcttgaaggagtatatggaagaa
gagatccccaaaaattacagcatcgctcaaaagcgggcactctttttccgctttgtagag
tttaatgaccccaactttggagatgaactgaaagcaaaggttctgcagcacatcttgaat
cctgctttcttgtacagctttgaaaagggggaaggagagcagctgttaggacctcctaat
ccagaaggagacaacccagagagcatcaccagtgtgtttataaccaaggtcctggaccct
gagaaacaagctgacatgctggactccctgcggatctacctcctgcagtacgccacgctg
ctggtggagcacgccccccaccacatccatgacaacaacaagaaccgcaacagcaagctg
cgccgtctgatgaccttcgcgtggccctgtctgctctccaaggcttgtgtggatcctgct
tgcaaatacagcgggcacctgctgctggcgcacatcatcgccaaatttgccatccataag
aaaatcgtcttgcaggttttccacagtcttctcaaggctcacgcaatggaagcccgagcg
attgtgagacaggcaatggccattttgaccccagcagtgccagcccgcatggaggacgga
caccagatgctgacacactggactaggaagatcatcgtggaggaggggcacacggtccca
cagctggtgcatattcttcacctcatagtgcagcactttaaggtgtactacccggtgcgg
caccacttggtacagcacatggttagtgccatgcagaggctgggcttcacacccagtgtc
accattgagcagaggaggctggccgtggacctctccgaggttgtcatcaagtgggaactg
cagaggatcaaggatcagcaaccggattctgacatggacccaaattccagtggagagggt
gtcaactcagtgtccattaagagaggcctgtctgtagactctgcacaggaggtgaaacgc
ttcagggcggccactggagccatcagcgcagtgttcgggaggagccagtccctgccggga
gctgactctcttcttgccaagcccattgacaagcagcacacagacactgtggtgaacttc
ctcattcgagtggcttgccaggtgaacgacaacaccaacacggcagggtcgcctggggag
gtgctctctcgccgctgtgtgaatcttctcaagaccgctctacggccagatatgtggtgc
aagtctgagctcaaactgcagtggtttgacaagctgctgatgaccgtggagcagcctaac
caggtgaactatgggaatatctgcacagggttggaagtcctgaacttcttgctaactgtg
ctgcagtctccggccatcctcagtagcttcaagcccctgcagcggggcatcgcagcctgc
atgacatgtgggaacaccaaggtgctgcgagctgtgcacagcctcctctctcgcctcatg
agcattttccctacagagccaagcacatcaagcgtggcctccaagtatgaggagctggag
tgcctctatgcggccgtggggaaggtcatctacgaaggcctcactaactacgagaaggcc
accagcgccaacccctcccagctcttcggaacacttatgatcctcaagtcagcctgttgc
aacaacccaagctacattgacaggctcatctctgtcttcatgcgctccctacagaagatg
gtccgagagcatctaaatccacagacagcatccgggagcaccgaagcaaccgcagctgga
acaagcgagttggtgatgctgagcctggatcttgtgaagactcgtctggcggtgatgagc
atggagatgcggaagaacttcatccagaccatcttgacctccctcattgagaagtcccca
gatgccaagatcctccgagctgtggtgaagattgtggaagaatgggttaagaataattcc
ccgatggcagccaatcagacacctacgctccgggagaagtcaatcttgcttgtgaaaatg
atgacttacatagagaaacgctttccagaagacctcgaactaaatgcccagtttttggac
cttgttaactatgtgtacagggatgaggcactttcaggcagtgagctgactgcaaagctt
gagcctgcctttctctctggactgcgttgtgcccaaccattgatcagggccaagtttttt
gaggtttttgacaactctatgaaacggcgcgtctacgaacggctgctgtatgtcacctgt
tcccagaattgggaagccatggggagccatttctggatcaagcagtgcattgagctcctc
ctggccgtgtgtgagaagagcactgccatcggtaccagctgccagggagccatgctcccg
tccattaccaacgtcatcaacctggccgacagccatgaccgagctgcctttgccatggtc
actcacgtcaagcaggaacctcgggaacgagagaacagtgagtctaaagaagaggacgta
gagattgacattgagctggctcctggcgatcagaccagcacacccaagaccaaagagctt
tccgagaaggacattgggaaccagctgcacatgctcaccaacagacacgacaagttcctt
gacactctccgggaggtgaagactggggcactgctcagcgccttcgttcagctctgccac
atttccacaacgttggccgagaagacctgggtccagcttttcccgaggctgtggaaaatc
ctctctgacagacagcagcatgcgctggcgggggagatcagccctttcctgtgcagcggc
agtcatcaggttcagcgagactgtcagcccagcgcattgaactgctttgtggaagccatg
tcccagtgcgtcccacccatccccatgcgaccctgtgtgctgaagtacctgggaaagact
cataacctctggttccgttccacgttgatgctggagcaccaggcctttgagaaggggctg
agtctgcccatcaaaccgaagcagacaaccgagttttatgagcaggagagcataacaccg
cctcagcaggagatcctggactccctcgctgaactttactctctgttacaagaagaggac
atgtgggccggcctgtggcagaagcgatgcaaattctccgagactgccaccgccattgct
tatgagcagcacggtttctttgagcaggcccaagaatcctacgaaaaggcaatggacaag
gcgaagaaagagcatgagcgcagtaatgcctccccggccattttccctgagtaccagctc
tgggaggaccactggattaggtgctccaaggagctgaaccagtgggaagccctgactgag
tttggccagtctaagggacacataaatccttaccttgtcctggagtgtgcgtggagggtg
tccaactggaccgccatgaaggaggcactggtgcaggtggaggtcagctgccccaaggag
atggcttggaaggttaacatgtaccgagggtacctggccatttgccaccccgaggaacag
cagctcagcttcattgagcgcctggtggagatggccagcagcttggctatccgtgagtgg
aggcggctgccccacgtggtgtcccatgtgcatacacctcttctgcaggctgcccagcag
atcatcgagcttcaggaggccgcacagatcaatgcaggcctgcagccgaccaacctgggc
cggaacaacagcctccacgacatgaagaccgtggtgaagacctggaggaaccggctgccc
atcgtgtctgacgacttgtcccactggagcagcgtcttcatgtggcggcagcaccattac
caggctattgtgactgcatatgaaaatagctctcaccatgacccaagctccaataacgcc
atgcttggagttcatgcctccgcctctgccatcatccagtatgggaaaattgcccggaaa
caaggtctggttaatgtggcgctggacatactgagccgaatccacaccatccccaccgtt
cccatcgtggattgcttccagaagattcgacagcaagtgaaatgctacctccagctggca
ggagtgatgggcaagaacgagtgcatgcagggccttgaagttattgagtctacaaaccta
aaatacttcacgaaggagatgacagctgagttttatgccctgaagggaatgttcctggct
cagatcaacaaatctgaggaggccaacaaagcgttctcggctgccgtgcagatgcacgat
gtgctggtgaaggcctgggccatgtggggggactacctggagagcatcttcgtgaaggag
cggcagctgcacctgggcgtgtctgccatcacctgctacctgcatgcctgccggcatcag
aacgagagcaagtccaggaagtacttggccaaggtgctgtggcttctgagtttcgatgat
gacaaaaacacgctggcggatgctgtagacaagtactgcatcggtgtacctcccatccag
tggctggcgtggatcccgcagctgctcacctgcctggtgggctctgagggcaagctgctg
ctgaacctcatcagccaggttggacgggtatatccccaggctgtctactttcccatccgg
actctgtacctgaccctgaagattgagcagagggagcgctacaagagtgattctggacag
cagcagcccagttcagcgggtaaccagtcccattctgcgtcagatccagggcccatcaga
gcgacagcgcccatgtggcgctgcagccggatcatgcacatgcagagggagctgcacccc
accctcctgtcctccctggaaggcatcgtcgaccagatggtctggttcagagagaactgg
cacgaagaggtgctcaggcagctccagcagggcctggcaaaatgttactctgttgccttt
gaaaagagcggtgcagtatcagacgccaagatcacccctcacactcttaactttgtcaag
aagctggtgagcactttcggggtcggcctggagaatgtgtccaacgtctcaaccatgttc
tctagtgcggcctccgagtccctggcccgccgcgcacaagccaccgcccaggaccctgtc
ttccagaagctgaagggccagttcaccacagatttcgacttcagtgtcccgggatccatg
aagcttcacaatctgatctctaaattgaaaaagtggatcaaaatcctcgaggctaaaacc
aagcagcttcccaagttcttcctcatagaagaaaaatgtcggttcttgagcaatttctca
gctcagacagctgaagtggagatccctggagagtttttgatgcctaagccaacacattac
tatatcaagatcgctcgctttatgccccgagtggagattgtgcagaagcacaacacagca
gcccgcaggctgcacatccgagggcacaacggcaagatctacccgtacctggtcatgaac
gatgcctgcctcacggagtcgcgcagggaggagcgagtgctgcagctgctgcgcctgctg
aacccttgcctggagaagaggaaggagaccaccaagaggcacttgttcttcacagttcct
cgggttgtggctgtgtccccgcagatgcgcctcgtggaagacaacccctcttcactttcc
ctcgtggagatctacaagcagcgctgtgccaagaaaggcattgagcatgacaaccccatc
tcccgttactatgacaggctggccacagtgcaggcacggggaacccaggccagccaccag
gtcctccgagacattctcaaagaggtccagagcaacatggtcccccgcagcatgctgaag
gagtgggccttgcacactttccccaacgctacagattactggaccttccggaagatgttc
accattcagttggcgctcatcggcttcgcagagtttgtcctgcacctaaataggctcaac
cctgagatgttgcagatcgctcaggacacgggcaagctgaacgttgcttacttccgattt
gacataaatgatgcaactggggacttagacgccaaccgtccagtccctttccgcctcacg
cccaacatatctgagttcctgaccaccattggtgtctctggcccgctgactgcctccatg
attgctgttgcacggtgctttgcccagcctaactttaaggtggacggcgttctgaaaact
gtgctccgggatgagatcattgcttggcacaaaaagacacaggaggacacttcctctcca
ctgtcggccgcagggcagcctgagaacatggacagccagcagctggtttccttagttcag
aaagccgtcactgccatcatgacccgcctgcacaacttggcccaattcgatggtggggag
agcaaggtgaacaccctggtggccgctgccaacagcctggacaacctctgtcgcatggac
cctgcctggcatccatggctgtga

DBGET integrated database retrieval system