KEGG   Mus musculus (mouse): 100705
Entry
100705            CDS       T01002                                 

Gene name
Acacb, AI597064, AW743042, Acc, Acc2, Accb
Definition
(RefSeq) acetyl-Coenzyme A carboxylase beta
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100705 (Acacb)
   00640 Propanoate metabolism
    100705 (Acacb)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100705 (Acacb)
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100705 (Acacb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100705 (Acacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100705 (Acacb)
   04922 Glucagon signaling pathway
    100705 (Acacb)
   04920 Adipocytokine signaling pathway
    100705 (Acacb)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100705 (Acacb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     100705 (Acacb)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100705 (Acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100705 (Acacb)
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3 GxGYxYP_N
Other DBs
NCBI-GeneID: 100705
NCBI-ProteinID: NP_598665
MGI: 2140940
Ensembl: ENSMUSG00000042010
Vega: OTTMUSG00000014407
UniProt: E9Q4Z2 Q9ESZ3 Q3UHC8
Position
5; 5 F
AA seq 2448 aa
MVLLLFLTCLVFSCLTFSWLKIWGKMTDSKPLTNSKVEANLLSSEESLSASELSGEQLQE
HGDHSCLSYRGPRDASQQRNSLPSSCQRPPRNPLSSNDTWPSPELQTNWTAAPGPEVPDA
NGLSFPARPPSQRTVSPSREDRKQAHIKRQLMTSFILGSLDDNSSDEDPSAGSFQNSSRK
SSRASLGTLSQEAALNTSDPESHAPTMRPSMSGLHLVKRGREHKKLDLHRDFTVASPAEF
VTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEY
IKMADQYVPVPGGPNNNNYANVELIIDIAKRIPVQAVWAGWGHASENPKLPELLCKHEIA
FLGPPSEAMWALGDKIASTIVAQTLQIPTLPWSGSGLTVEWTEDSRHQGKCISVPEDVYE
QGCVKDVDEGLQAAEKIGFPLMIKASEGGGGKGIRKAESAEDFPMLFRQVQSEIPGSPIF
LMKLAQNARHLEVQVLADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIAAPAVFEFMEQC
AVLLAKMVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMG
VPLHRLKDIRLLYGESPWGVTPIPFETPLSPPIARGHVIAARITSENPDEGFKPSSGTVQ
ELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDF
RTTVEYLVNLLETESFQNNDIDTGWLDHLIAQRVQAEKPDIMLGVVCGALNVADAMFRTC
MTEFLHSLERGQVLPADSLLNIVDVELIYGGIKYALKVARQSLTMFVLIMNGCHIEIDAH
RLNDGGLLLSYNGSSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLMQYTV
EDGDHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGVILEAGCVVARLELDDPSKVH
AAQPFTGELPAQQTLPILGEKLHQVFHGVLENLTNVMSGYCLPEPFFSMKLKDWVQKLMM
TLRHPSLPLLELQEIMTSVAGRIPAPVEKAVRRVMAQYASNITSVLCQFPSQQIATILDC
HAATLQRKADREVFFMNTQSIVQLVQRYRSGTRGYMKAVVLDLLRKYLNVEHHFQQAHYD
KCVINLREQFKPDMTQVLDCIFSHSQVAKKNQLVTMLIDELCGPDPTLSDELTSILCELT
QLSRSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSE
TTIFDVLPTFFYHENKVVCMASLEVYVRRGYIAYELNSLQHRELPDGTCVVEFQFMLPSS
HPNRMAVPISVSNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEEFTRNFDEVISCFA
NVQTDTLLFSKACTSLYSEEDSKSLREEPIHILNVAIQCADHMEDEALVPVFRAFVQSKK
HILVDYGLRRITFLVAQEREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRNFDL
TAVPCANHKMHLYLGAAKVKEGLEVTDHRFFIRAIIRHSDLITKEASFEYLQNEGERLLL
EAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPLKIEESVRDMVMRYGSRLWKLRVLQA
EVKINIRQTTSDSAIPIRLFITNESGYYLDISLYREVTDSRSGNIMFHSFGNKQGSLHGM
LINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWGSPEKYPKDILTYTELVL
DSQGQLVEMNRLPGCNEVGMVAFKMRFKTPEYPEGRDAVVIGNDITFQIGSFGIGEDFLY
LRASEMARTEGIPQIYLAANSGARMGLAEEIKQIFQVAWVDPEDPHKGFRYLYLTPQDYT
QISSQNSVHCKHIEDEGESRYVIVDVIGKDANLGVENLRGSGMIAGEASLAYEKTVTISM
VTCRALGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHTNG
VSHVTVPDDFEGVCTILEWLSFIPKDNRSPVPITTPSDPIDREIEFTPTKAPYDPRWMLA
GRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVAVPA
DPANLDSEAKIIQQAGQVWFPDSAYKTAQVIRDFNKERLPLMIFANWRGFSGGMKDMYEQ
MLKFGAYIVDGLRLYEQPILIYIPPCAELRGGSWVVLDSTINPLCIEMYADKESRGGVLE
PEGTVEIKFRKKDLVKTIRRIDPVCKKLVGQLGKAQLPDKDRKELEGQLKAREELLLPIY
HQVAVQFADLHDTPGHMLEKGIISDVLEWKTARTFFYWRLRRLLLEAQVKQEILRASPEL
NHEHTQSMLRRWFVETEGAVKAYLWDSNQVVVQWLEQHWSAKDGLRSTIRENINYLKRDS
VLKTIQSLVQEHPEVIMDCVAYLSQHLTPAERIQVAQLLSTTESPASS
NT seq 7347 nt   +upstreamnt  +downstreamnt
atggtcttgcttctctttctgacttgcctggttttctcctgcctgaccttttcctggcta
aaaatctgggggaagatgacagactcgaagccgctcaccaacagtaaggtggaagccaat
ctcctttcaagcgaggagtccctttcagcctcagagctgtcaggggaacagctgcaggaa
catggcgaccacagctgtctgtcctacagaggtcccagagacgccagtcagcagaggaac
tccctgccaagctcatgccagaggcctccgaggaacccactgtcttccaatgacacctgg
ccctccccagaactccaaaccaactggacagccgccccgggcccagaggttccagatgct
aatgggttgtccttcccagccaggcccccgagccagaggacagtatccccctccagagag
gacaggaagcaggcacacatcaagagacagctgatgaccagctttatcctgggctccctg
gatgacaactcctctgatgaggaccctagtgccggctccttccagaactcctcccggaag
agcagcagggctagcctgggcactctgtcccaggaggctgcattgaacacaagtgatcct
gaatctcacgcgcctactatgaggcccagcatgtctggactccatctggtgaagagaggc
cgagaacacaagaaactggacctgcacagagatttcaccgtcgcgtccccagccgagttt
gtcactcggtttggaggcaacagggtcatagagaaggtgctcatcgccaacaatggcatc
gctgcggtcaagtgtatgcgctccatccgccgctgggcctacgagatgttccgtaatgaa
cgtgccatccggttcgtggtcatggtgacgcccgaggatctgaaggccaacgcagagtac
atcaagatggccgatcagtacgtccctgtcccaggaggacccaataacaacaactatgcc
aatgttgagctgatcatagacattgccaagagaatccctgtacaggccgtgtgggctggc
tggggccacgcttcggaaaaccccaaacttccagagctgctgtgtaaacacgagattgct
ttcctaggtccccccagtgaggccatgtgggccctgggagacaagatcgcctccaccatc
gtagcgcagacactgcaaatcccaaccttaccctggagtggaagcggtctcacagtggag
tggacggaggacagccggcaccagggcaaatgcatcagtgtccccgaagacgtttacgag
cagggctgtgtgaaggatgtggacgaaggcttgcaggcagcagaaaaaataggatttcct
ttgatgatcaaagcctccgaaggcggaggcgggaaaggtatccgcaaggctgagagtgca
gaggacttcccgatgcttttccgacaagtgcagagtgagattccgggctcgccgatcttt
ctaatgaagctggcccagaacgcacggcacctggaggtccaggtcttggcagatcagtat
ggaaacgcggtgtcactgttcggacgggactgttccattcagaggcggcaccagaagatc
attgaggaggctccggccaccatcgccgcgcctgccgtgtttgagttcatggaacagtgt
gctgtcctcctggccaagatggtgggttatgtgagcgcggggactgtggagtacttatac
agccaggatggcagcttccacttcctggagctgaacccacgcctgcaggtggagcatccg
tgcactgaaatgatcgcagatgtcaacctgcctgctgcgcagttgcagatcgccatgggc
gtgcccctgcaccgactgaaggacatacggcttctgtacggagagtccccctggggagtg
acccccattccttttgaaacccccttgagccctcccattgcccgaggccacgtcattgca
gccaggatcaccagcgaaaacccagatgagggctttaagccaagctcggggacagtgcag
gagctgaacttccgcagcaacaagaacgtgtggggttacttcagcgtggccgctgctggg
ggcttgcacgagttcgccgattcccagtttgggcactgcttctcctggggcgagaaccgt
gaagaggccatttcgaacatggtagtggctttgaaggaactgtccatccggggtgacttc
cggaccactgtggagtatctcgttaaccttctggagaccgagagcttccagaacaacgat
atcgacacggggtggctggaccacctcatcgctcagcgggtgcaggcagagaagccggac
atcatgcttggggtggtgtgtggggccttgaatgtggcagacgcgatgttcagaacctgc
atgacggaattcttgcactccctggaaaggggtcaggtcctccctgctgattctctgctg
aacattgtggacgttgaattgatttacggcggcatcaagtatgctctcaaggtagcccga
cagtccctgactatgtttgtcctcatcatgaacggctgccacatcgagatcgatgcccac
cggctgaacgatggggggctgctcctgtcctacaatggcagcagttacactacgtacatg
aaggaagaggttgacagttaccggatcactatcggcaataagacttgcgtgtttgaaaag
gaaaacgaccccactgtcctgagatccccctcggctgggaagctgatgcagtatacggtg
gaggacggagaccacgtggaagctgggagcagctacgcggagatggaggtgatgaagatg
atcatgaccctgaacgtgcaggagagcggccgggtgaagtacatcaagcggccaggggtt
atactggaggctggctgcgtggtggcgaggctagaactcgatgacccttcaaaagtgcac
gcggcccagccgtttactggggagctccctgcccagcagactctgcccatcctcggggag
aagctacaccaagtgttccacggcgtcttggaaaatctgaccaatgtcatgagtggctac
tgcctgcccgagcccttcttcagcatgaagctgaaggactgggtccagaagctcatgatg
acgctccggcatccctccctacctctgctggagctacaggagatcatgaccagtgtggcc
ggccgcatccccgccccggtggagaaggcagtccgcagggtgatggcccagtacgccagt
aacatcacctccgtgctatgccagttccccagccagcagatagccaccatcctggactgc
catgccgccaccctgcagcgtaaggcggaccgagaggtcttcttcatgaacacacagagc
atcgtgcagctggtccagagataccgcagcgggacccgtggctacatgaaggctgtggtg
ctggacctcctgaggaaatatctaaacgtggagcaccattttcagcaagcccactatgac
aagtgtgtgatcaacctgagggagcagttcaagccggacatgacccaggtgctggactgc
atcttctcacactcccaggtggccaagaagaaccagctggtgaccatgctgatagatgag
ctgtgcggcccagaccccaccctgtcagacgagctgacctccatcctctgtgagctcacg
cagctgagcagaagcgagcactgcaaggttgccctcagagccagacaggtcctgatcgcc
tcccacctcccctcctacgagctgcggcacaaccaggtggagtccatcttcctgtccgcc
atcgacatgtacggccaccagttctgcccagaaaatctcaagaaactaatactttcagaa
acgaccatattcgacgtcctgcccactttcttctatcacgagaacaaggttgtctgtatg
gcgtccctggaggtttacgtgcggagaggctacatcgcctacgagctaaacagcctgcag
caccgggagctcccagatggcacctgtgtggtggagttccagttcatgctgccctcttcc
caccccaaccggatggccgtgcccatcagtgtctccaaccccgacctgctgaggcacagc
acagaactcttcatggacagtggcttctccccactgtgccagcggatgggggccatggtg
gccttcaggagatttgaagaattcaccaggaactttgatgaagtcatctcctgctttgcc
aacgtgcagacagacactcttctcttcagtaaggcgtgcacttccctgtactcagaggaa
gacagcaagagcctccgagaggaacccatccacatcctgaatgtggccatccagtgtgcc
gaccacatggaggacgaggcgctggtgccagtcttccgtgcctttgtacagtccaagaag
cacatccttgtggattacggactccgaagaatcacattccttgttgcccaagagagagaa
ttccccaagttcttcacgttcagagcgagggatgagtttgcagaagaccggatttatcgc
cacttggagcctgccctggccttccagctggagctgagccggatgcgcaactttgacctg
accgctgtgccctgtgccaaccacaagatgcatctttacctgggagccgctaaggtgaag
gaagggttggaggtgaccgaccacaggttctttatccgagccattatccggcactcagac
ctgatcaccaaggaagcctccttcgagtacctgcagaacgaaggtgagcggctgctgctg
gaagccatggacgagctggaggtggcgttcaacaacaccagtgtgcgcactgactgcaac
cacatcttcctcaactttgtgcccacagtcatcatggacccgctcaagatcgaggagtcg
gtgcgtgacatggtcatgcgctatggcagccgtctgtggaagctccgagtgctgcaggcc
gaggttaagatcaacatccgtcagacaacctcagatagtgccatccccatccgcctcttc
atcaccaacgagtctggctactacctggacatcagcctctatagagaagtgacggactcc
agatccggaaatatcatgtttcattcctttggcaacaagcaaggtagcctgcatgggatg
ctgatcaatacaccctatgtcaccaaggacctgctccaggctaagcgattccaggcacag
tccctcgggaccacctatgtgtacgacttcccagagatgttcaggcaggctctctttaaa
ctgtggggctccccagagaagtaccccaaagatatcctgacatacacagagctggtgttg
gactctcaaggtcagctggtggagatgaaccggcttcctggttgtaacgaggtgggcatg
gtggccttcaaaatgaggttcaagaccccggagtatccagaaggccgggacgccgttgtc
atcggcaatgacatcaccttccaaatcggctctttcggcataggggaggacttcctgtac
ctgcgagcgtctgagatggcccggacagagggcatcccccaaatctacctggcagctaac
agcggggcccgtatgggcctggctgaggagatcaaacagatattccaagtggcttgggtg
gacccagaggatccccacaaaggatttagatacctgtacctgacgccccaagactacacc
cagatcagttcccagaactcagtgcactgcaagcacatcgaagatgaaggcgaatccaga
tacgtcatcgtggatgtcatcgggaaggatgccaacctgggtgtggagaacctgaggggc
tcgggcatgattgcaggagaagcttccctggcttatgagaaaacggtcaccatcagcatg
gtgacctgccgcgcccttggaatcggggcttacctggtgaggcttggccagcgggtgatc
caggtggaaaactcccacatcatcctcaccggagccggtgctctcaacaaggtcctggga
agagaggtctacacgtccaacaaccagctaggtggcgtgcagatcatgcataccaacggg
gtctcccacgtcaccgtgccagatgacttcgagggggtctgcaccattctggaatggctg
tcatttataccgaaggacaatcgcagcccggtccccatcaccactccttctgaccccatc
gacagggaaattgaattcaccccaaccaaagctccctacgaccccaggtggatgcttgca
ggcaggcctcacccaactctgaaggggacctggcagagtggattcttcgaccatggcagt
ttcaaggaaatcatggcaccctgggcccagactgtggtgacgggacgagcaaggctgggg
ggcatccctgtgggagtgattgctgtggagactcggactgtggaggtggctgtccccgct
gaccctgccaacttggattctgaggccaagatcatccagcaggcgggccaggtgtggttc
ccggactcggcctacaagacggcgcaggtcatcagggacttcaacaaggagcgcctgcct
ctcatgatcttcgccaactggaggggcttctccggaggcatgaaggacatgtatgagcag
atgctgaagtttggcgcctacatcgtggatggtctccgcctgtacgagcagcccattctc
atctacatccctccctgtgcggagctccgtgggggctcctgggttgtcctggactccacc
atcaaccccctgtgcatagagatgtatgcagacaaagagagcagggggggtgttctggag
ccggagggcacggtggagattaagttccggaagaaagatctggtgaaaaccataaggagg
atagacccagtgtgtaagaagctcgtgggacagctggggaaagcccagcttcccgacaag
gaccggaaggagctggagggccagctgaaggcccgggaggaactgctgcttcccatctac
caccaggtggcagtgcagttcgcagacctgcacgacaccccgggccacatgctggagaaa
ggaatcatttctgatgtgctggaatggaagactgcccgcaccttcttctactggaggctg
cgccggctgctgctggaggcccaggtgaagcaggagatactccgagccagccccgagctg
aaccacgagcacacacagtccatgctgcgacgctggttcgtggagactgagggcgctgtc
aaggcctacctgtgggacagcaaccaggtggtggtccagtggctggaacagcactggtca
gccaaggacggcttgcgctccaccatccgtgaaaacatcaattatctgaagcgggactct
gtcctcaagaccatccaaagtctggtccaagaacatccagaggtcatcatggactgcgtg
gcctacctgagccagcacctcacgccagccgagcggatacaggtggctcagctgctgtct
accacggagagcccagcttcctcctga

KEGG   Mus musculus (mouse): 107476
Entry
107476            CDS       T01002                                 

Gene name
Acaca, A530025K05Rik, Ac, Acac, Acc, Acc1, Gm738
Definition
(RefSeq) acetyl-Coenzyme A carboxylase alpha
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
Module
mmu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107476 (Acaca)
   00640 Propanoate metabolism
    107476 (Acaca)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107476 (Acaca)
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    107476 (Acaca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107476 (Acaca)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107476 (Acaca)
   04922 Glucagon signaling pathway
    107476 (Acaca)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     107476 (Acaca)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     107476 (Acaca)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     107476 (Acaca)
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3
Other DBs
NCBI-GeneID: 107476
NCBI-ProteinID: NP_579938
MGI: 108451
Ensembl: ENSMUSG00000020532
Vega: OTTMUSG00000000985
UniProt: Q5SWU9
Position
11; 11 C
AA seq 2345 aa
MDEPSPLAKTLELNQHSRFIIGSVSEDNSEDEISNLVKLDLEEKEGSLSPASVSSDTLSD
LGISGLQDGLAFHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKV
LIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGG
PNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALG
DKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAA
EEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQ
ILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAG
TVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYG
VSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYF
SVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETE
SFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVL
PAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGS
SYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAE
IEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQS
TALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQD
IMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVF
FMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDM
NTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRA
RQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHS
NQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMS
FASNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVSFRTFEDFVRIFDEIMGCFCDSPP
QSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVE
HGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQL
ELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEY
LQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGS
RLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAY
GDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAF
LPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPDGRDIIVIG
NDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDP
EDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSG
MIAGESSLAYDEVITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGRE
VYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDR
IIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGI
PVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLM
VFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTIN
PRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTER
KELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRR
LLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTEE
DGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTM
DSPST
NT seq 7038 nt   +upstreamnt  +downstreamnt
atggatgaaccatctccgttggccaaaactctggagctaaaccagcactcccgattcata
attgggtctgtgtctgaagacaactcagaagatgagatcagtaacctggtgaagctggac
ctagaagagaaggagggctccctgtcaccagcctccgtcagctcagatacactttctgat
ttggggatctctggcttacaggatggtttggcctttcacatgagatccagcatgtctggc
ttgcacctagtaaaacaaggtcgagacagaaagaaaatagactcacaacgagatttcact
gtggcttctccagcagaatttgttactcgttttgggggaaataaagtaattgagaaggtt
cttatcgccaacaatggtattgcagcagtgaaatgcatgcgatctatccgtcggtggtct
tatgaaatgtttcgaaatgaacgtgcaatccgatttgttgtcatggttacacctgaagac
cttaaagccaatgcagaatacattaagatggcagaccactatgttccagtgcctggagga
cccaacaacaacaattacgcaaatgtggagttgattcttgatattgctaaaaggatacct
gtacaagcagtgtgggctggctggggtcatgcctctgagaacccgaaactcccagaactg
ctcttaaaaaatggcattgctttcatgggccctccaagccaggccatgtgggctttgggg
gataagattgcatcttctattgtggctcaaactgcaggtatcccaactcttccctggagt
ggcagtggtcttcgagtggattggcaagaaaatgatttttcgaaacgtatcttaaatgtt
ccacaggatctgtatgagaaaggctatgtgaaggatgtggatgatggtctgaaggcagct
gaggaagttggctatccagtgatgatcaaggcctcagagggaggaggagggaaagggatc
agaaaagttaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaagtt
cctggatcacctatatttgtaatgagactagcaaaacaatctcgacatctggaggtccag
attctggcagatcagtatggcaatgctatttctttgtttggtcgtgactgctctgtgcag
cgcaggcatcagaagatcattgaagaagctcctgctgcgattgctaccccagcagtattt
gaacacatggaacagtgtgcagtgaaacttgccaaaatggttggttatgtgagtgctggg
actgtggaatacttgtacagccaggatggaagcttctactttttggaactgaaccctcgg
ctacaggttgaacatccttgtacagagatggtggctgatgtcaatcttcctgcagcacag
ctccagattgccatggggatccctctatttaggatcaaggatattcgtatgatgtatggg
gtatctccttggggagatgctcccattgattttgaaaattctgctcatgttccttgccca
aggggccacgtgattgctgctcggatcaccagtgaaaacccagatgaggggtttaagccc
agctctggaacagttcaggaacttaattttcgtagcaataagaacgtttggggttatttc
agtgttgctgctgctggaggacttcatgaatttgctgattctcagttcgggcactgcttt
tcctggggagaaaacagggaggaagcaatctcaaatatggtggtggcactgaaggagctg
tctattcggggtgactttcgaactacagtggaatacctcatcaaactgctggagacagaa
agctttcagcttaacagaatcgacactggctggctggacagactgatcgcagagaaagtg
caggcagagcgacctgacaccatgttgggagttgtgtgtggggctctccatgtagcagat
gtgagcctgaggaacagcatctctaacttccttcactccttagagaggggtcaagtcctt
cctgctcacacacttctgaacacagtagatgttgaacttatctatgaaggaatcaaatat
gtacttaaggtgactcggcagtctcccaactcctacgtagtgataatgaatggctcgtgt
gtggaagtggatgtgcatcggctgagtgatggtggcctgctcttgtcttatgacggcagc
agttacaccacatacatgaaggaagaggtggacagatatcgaatcacaattggcaataaa
acctgtgtgtttgagaaggaaaatgacccatctgtaatgcgctcaccgtctgctgggaag
ttaatccagtatattgtggaagatggcggacatgtgtttgctggccagtgctatgctgag
attgaggtaatgaagatggtgatgactttaacagctgtagaatctggctgcatccattat
gtcaaacgacctggagcagcacttgaccctggctgtgtgatagccaaaatgcaactggac
aaccccagtaaagttcaacaggctgagcttcacacgggcagtctaccacagatccagagc
acagctctcagaggcgagaagctccatcgagttttccactatgtcctggataacctggtc
aatgtgatgaatggatactgccttccagaccctttcttcagcagcagggtaaaagactgg
gtagaaagattgatgaagactctgagagacccctccttgcctctgctagagctgcaggat
atcatgaccagtgtctctggccggatccccctcaatgtggagaagtctattaagaaggaa
atggctcagtatgctagcaacatcacatcagtcctgtgtcagtttcccagccagcagatt
gccaacatcctagatagtcatgcagctacactgaaccggaaatctgagcgggaagtcttc
ttcatgaacacccagagcattgtccagctggtgcagaggtaccgaagtggcatccgtggc
cacatgaaggctgtggtgatggatctgctgcggcagtacctgcgagtagagacacagttt
cagaacggccactacgacaaatgtgtattcgcccttcgggaagagaacaaaagcgacatg
aacaccgtactgaactacatcttctcccacgctcaggtcaccaaaaagaatctcctggtg
acaatgcttattgatcagttatgtggccgggaccctacacttactgatgagctgctaaat
atcctcacagagctaacccaactcagcaagaccaccaacgctaaagtggcgctgcgcgct
cgtcaggttcttattgcttcccatttgccatcatatgagcttcgccataaccaagtagag
tctatcttcctatcagccattgacatgtatggacaccagttttgcattgagaacctgcag
aaactcatcctctcggaaacatctattttcgatgtcctcccaaactttttttaccacagc
aaccaggtggtgaggatggcagctctggaggtgtatgttcgaagggcttacattgcctat
gaactcaacagcgtacaacaccgccagcttaaggacaacacctgtgtggtggaatttcag
ttcatgctgcccacatcccatccaaacagagggaacatccccacgctaaacagaatgtcc
tttgcctccaacctcaaccactatggcatgactcatgtagctagtgtcagcgatgttctg
ttggacaacgccttcacgccaccttgtcagcggatgggcggaatggtctctttccggacc
tttgaagattttgtcaggatctttgatgaaataatgggctgcttctgtgactccccaccc
caaagccccacattcccagagtctggtcatacttcgctctatgatgaagacaaggtcccc
agggatgaaccaatacatattctgaatgtggctatcaagactgatggcgatattgaggat
gacaggcttgcagctatgttcagagagttcacccagcagaataaagctactttggttgag
catggcatccggcgacttacgttcctagttgcacaaaaggatttcagaaaacaagtcaac
tgtgaggtggatcagagatttcatagagaattccccaaatttttcacattccgagcaagg
gataagtttgaggaggaccgcatttatcgacacctggagcctgctctggctttccagtta
gagttgaaccggatgagaaattttgaccttactgccatcccatgtgctaatcacaagatg
cacctgtaccttggggctgctaaggtggaagtaggcacagaagtgactgactacaggttc
tttgttcgtgcgatcatcaggcactctgatctggtcacaaaggaagcttctttcgaatat
ctacaaaatgaaggggaacgactgctcctggaagctatggatgaattggaagttgctttt
aataatacaaatgtccgcactgactgtaaccacatcttcctcaactttgtgcccacggtc
atcatggacccatcaaagattgaagaatctgtgcggagcatggtaatgcgctatggaagt
cggctatggaaattgcgggtcctccaggcagaactgaaaatcaacattcgcctgacaaca
actggaaaagcaattcccatccgcctcttcctgacaaacgagtctggctactacttggac
atcagcctgtataaggaagtgactgactccaggacagcacagatcatgtttcaggcatat
ggagacaagcagggaccactgcatggaatgttaattaatactccatatgtgaccaaagac
cttcttcaatcaaagaggttccaggcacagtccttaggaacaacatatatatatgatatc
ccagagatgtttcggcagtcactcatcaaactctgggagtccatgtccacccaagcattt
cttccttcgcctcctttgccttccgacatcctgacgtatactgaactggtgttggatgat
caaggccagctggtccatatgaacagacttccaggaggaaatgagattggcatggtagcc
tggaaaatgagccttaaaagccctgaatatccagatggccgagatatcattgtcatcggc
aatgacattacatatcggatcggttcctttgggcctcaggaggatttgctgtttctcaga
gcttctgaacttgccagagcagaaggcatcccacgcatctacgtggcagcgaacagtgga
gctagaattggacttgcagaagaaatacgccatatgttccatgtggcctgggtagatcct
gaagatccctacaagggatacaagtatttatatctgacaccccaggattataagagagtc
agtgccctcaattctgtccactgtgaacatgtggaggatgaaggggaatccaggtacaag
ataacagatattatcgggaaagaagaaggacttggagcagagaaccttcggggttctgga
atgattgctggggaatcctcattggcttacgatgaggtcatcaccatcagcctggttaca
tgccgggccattggtattggggcttaccttgtccggctgggacaaagaaccatccaggtt
gagaattctcacttaattctgacaggagcaggtgccctcaacaaagtccttggtcgggaa
gtatacacctccaacaaccagcttgggggcatccagattatgcacaacaatggggttacc
cactccactgtttgtgatgactttgagggagtcttcacagtcttacactggctgtcatac
atgccgaagagcgtacacagttcagttcctctcctgaattccaaggatcctatagataga
atcatcgagtttgttcccacaaaggccccatatgatcctcggtggatgctagcaggccgt
cctcacccaacccagaaaggccaatggttgagtgggttttttgactatggatctttctca
gaaatcatgcagccctgggcacagaccgtggtagttggcagagccaggttagggggaata
cccgtgggagtagttgctgtagaaacccgaacagtggaactcagtatcccagctgatcct
gcgaacctggattctgaagccaagataatccagcaggccggccaggtttggttcccagac
tctgcatttaagacctatcaagctatcaaggactttaaccgtgaagggctacctctaatg
gtctttgccaactggagaggtttctctggtgggatgaaagatatgtatgaccaagtgctc
aagtttggcgcttacattgtggatggcttgcgggaatgttcccagcctgtaatggtttac
atcccgccccaggctgagcttcggggtggttcttgggttgtgatcgaccccaccatcaac
cctcggcacatggagatgtacgctgaccgagaaagcaggggatctgttctggagccagaa
gggacagtagaaatcaaattccgtaaaaaggatctggtgaaaaccatgcgtcgggtagat
ccagtttacatccgcttggctgagcgattgggcaccccagagctaagccccactgagcgg
aaggagctggagagcaagttgaaggagcgggaggagttcctaattcccatttaccatcag
gtagctgtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgtc
attaacgatatcttggattggaaaacatcccgcaccttcttctactggaggctgaggcgc
ctcctgctggaggacctggtcaagaagaaaatccacaatgccaaccctgagctgactgac
ggccagatccaggccatgttgagacgctggtttgtagaagttgaaggcacagtgaaggct
tacgtctgggacaataataaggacctggtggagtggctggagaagcaactgacagaggaa
gatggcgtccgctctgtgatagaggagaacatcaaatacatcagcagggactatgtcctg
aagcagatccgcagcttggtccaggccaacccagaagtcgccatggactccatcgtccac
atgacccagcacatctcacccacccagcgagcagaagttgtaaggatcctctccactatg
gattccccttccacgtag

DBGET integrated database retrieval system