KEGG   Mus musculus (mouse): 100756
Entry
100756            CDS       T01002                                 

Symbol
Usp30, 6330590F17Rik, AI851327, D5Ertd483e
Name
(RefSeq) ubiquitin specific peptidase 30
  KO
K11851  ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100756 (Usp30)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    100756 (Usp30)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    100756 (Usp30)
   04121 Ubiquitin system [BR:mmu04121]
    100756 (Usp30)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100756 (Usp30)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   100756 (Usp30)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100756 (Usp30)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100756 (Usp30)
SSDB
Motif
Pfam: UCH UCH_1 DUF5700
Other DBs
NCBI-GeneID: 100756
NCBI-ProteinID: NP_001028374
MGI: 2140991
Ensembl: ENSMUSG00000029592
Vega: OTTMUSG00000016815
UniProt: Q3UN04
Position
5 F; 5 55.96 cM
AA seq 517 aa
MLSSRAQAARTAADKALQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFVKWLEEFTTQYSRDQQGPHTHQCLSLTL
LNLLKALSCQEVTEDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQSEMAPRQVTCHTRGSPHPTTNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEARGTLTGEK
VEHQRSTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDFYKYRLLG
HKPSQHGPKATENPGSAPEVQDAQAAPKPGLSQPGAPKTQIFLNGACSPSLLPALPSPVA
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSAKNPLSTSNQWLWISDDT
VRKASLQEVLSSSAYLLFYERVLSRVQQQGREYRSEE
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgctaagttcccgggcgcaggcggcgaggacggcggccgacaaggccctgcagcgcttc
ctgcgcaccggggcggccgtcagatacaaagtcatgaagaactggggagtgatcggtggg
attgccgctgccctggcagcagggatctatgttatttggggtcccattacagagaggaag
aagcggagaaaagggcttgtgcctggccttgtcaatctggggaatacctgcttcatgaac
tcgctgctgcagggcctgtctgcctgccctgcgtttgtcaagtggctggaagagtttacc
acccagtactccagggaccagcaggggccacacactcaccagtgcctgtccttaacactg
ctgaacctcctgaaagctctgtcctgccaagaagtcaccgaggacgaggtcttggacgcc
agctgtctgctggacgtcctgagaatgtacagatggcagatctcgtcctttgaggagcag
gatgctcacgagctgtttcatgtcatcacctcatcactggaggacgagagagaccgccag
cctcgagtcacccacttgtttgatgtgcattccctggagcagcagtcagaaatggctccc
agacaagtcacttgccacacgagagggtcccctcaccccacgaccaatcactggaagtct
cagcaccctttccatggaagactcaccagtaacatggtgtgcaaacactgtgaacaccag
agtcctgttcggtttgacacctttgacagcctttctctcagtattccagctgccacttgg
gggcacccactgacactggaccactgccttcaccacttcatctcatcagagtccgtgcga
gacgttgtgtgtgacaactgtacaaagattgaagcgagggggacactgaccggggagaag
gtggagcatcagaggagcacctttgttaaacagttaaaactcggaaagctgccacagtgc
ctctgcatccacctgcagcggctcagctggtccagccacggcacgcccttgaagcggcac
gagcacgtgcagtttaacgagttcctgatgatggacttctacaagtaccgcctcctggga
cacaagcccagccagcatggccccaaagccaccgagaacccagggtctgccccagaagta
caggacgcacaggcggccccaaagccaggtctgagtcagccaggggcccccaagacacag
atttttctgaatggcgcctgctccccgtctctgttgccagccctgccttccccggtggcc
ttccctctgccagtggttcctgactacagctcctccacatacctcttccgcttgatggca
gttgtcgttcaccatggagacatgcactctggacactttgtcacctacagacggtcacca
ccttctgccaagaaccctctctcaaccagcaaccaatggctgtggatttctgacgacacc
gtccgcaaggccagcctgcaggaggtcctgtcctctagtgcctacctgctgttctatgag
cgagttctgtccagggtgcagcagcaggggcgagagtataggtctgaggagtga

DBGET integrated database retrieval system