KEGG   Mus musculus (mouse): 100861891Help
Entry
100861891         CDS       T01002                                 

Gene name
Gm21304
Definition
(RefSeq) predicted gene, 21304
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 FYTT DUF1645 TFIIA FoP_duplication Septin Anoctamin DDHD Presenilin
Motif
Other DBs
NCBI-GeneID: 100861891
NCBI-ProteinID: NP_001257830
MGI: 5434659
Ensembl: ENSMUSG00000097550
Vega: OTTMUSG00000042981
UniProt: J3QP73
Position
10 D1; 10
AA seq 264 aa AA seqDB search
MTTMADKMDMSLEDIIKLTKIQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRP
KQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYD
RCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQGRPAQSKNRGGM
TRNPGSGVLSGGGTKKWTLGGSQGRGRGTIRNSKLQQQQQQQKQKQQQQQQKQQQKQQQK
QQQQLSAEELDAQLDAYQEMMDTS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactaccatggctgacaaaatggacatgtcattggaagacatcattaagctgaccaag
atccagcaaagacgtcatgacaggcctgattcccgggtgaatcgaggcactgggtctaag
aggtataggccagctttcacccatggtggaaggaacaggctggcaccatactgcagacca
aaacaacttccagacaagtggcagcatgacctgttcattggaggcttcaggggtcaaaac
cacgtggatactggtgggaagctcttcttgtcaaatctgcacttcggagtgtcagatgct
gatattcagctactctttgctgaatttggaacgttgaagaaatctgctgtgcactatgat
cgctgtggacgaagtttagggacagcacaggtgcactttgaaaggaaagcagatgccctg
aaggctatgagagagtacaatggcgcccctttggatggccgccctatgaacatccagctt
gccacctcacagattgatagacaaggaagacctgcacaaagcaaaaataggggcggcatg
acaagaaaccctggctctggagtattaagtggtggaggcaccaagaaatggacacttgga
ggcagccagggaagagggagaggcaccatcaggaactcaaaactgcagcaacagcagcag
cagcagaagcagaagcagcagcagcagcagcagaagcagcagcagaagcagcagcagaag
cagcagcagcagctatctgcagaggagctggatgcccagctggatgcttatcaggaaatg
atggacaccagctga

DBGET integrated database retrieval system