KEGG   Mus musculus (mouse): 100862324Help
Entry
100862324         CDS       T01002                                 

Definition
(RefSeq) protein FAM205A-2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4599 FAM75
Motif
Other DBs
NCBI-GeneID: 100862324
NCBI-ProteinID: XP_003689294
Ensembl: ENSMUSG00000079774
UniProt: C0HKD1 C0HKD2 C0HKD3
Position
4
AA seq 1308 aa AA seqDB search
MLSTMCFLWDTECPLYVYFCFFIIVLIVWQVRQNYQGLKCENRRSCCRRHQKVRQRAKDA
ASRARRLSREEDEKPCELLSIMKSQSWVPKQGNVRQLLCLDPSCQICEATTLEIRQLLQS
KKSQISPALLGLPQRAACLEMPISSESFEWNQDFYSRYSTNSPVVPGNQTLTQLTEELTE
STNADGVLLCWTDPLQIGQEFHLADMPMASETLVSPGLEEPVVLMNEEDTVHSNLNYIQQ
LQDHEALNSQIPFQTLTPQLTVTHPMAVSIVTDAPQPFLSPEVLRLLEIHVKKLMHFQRW
GLPRRVEESLKQFMPNPPVYLPPEHNQPVSFILNTSSQDCVHRFEGISPETWYSYMDGQP
IQTFWVSEWSSGDQGQRLSCKPIPSPVEKPLLTPDYELLHDLCLSPEGQVDGSQSNLQKK
FTQLFCGLPSMHSESLGSTFLCTQGVSKNTLKPPYKEPHFLKVSPPIPLPEAAPPPSSTS
PNESLDEPQRAQIGGVPFLTLSECKTLEWHLLQRQLQLQWGLPAVIARPPRVQSHTQYKH
KPWNKAKPRETLKFFGPGKPFSALTRELFFIPQHARRLLEFHLQKRLIHLRWGLPQRIQR
SINMLLSSTDLQSLPCGGSRLPNVSISQPGKPEAYGSGDTFLPTAGKGTTPMPHLFAKAQ
EMLKSHDTKCEQIREGKVPACVQSAWKGRIPGDLAAGTLFPNIPQGQPLELQAENNPDLH
QEAVSWKPMDLDQEAQAFSGVFIEHCRRPQALSEETIKKLETTLRHKYLAFLSGLQALYC
MAPTKATSPTVDQSVITTMPWSVKSPQKPLSQKSPLEALCLSGLEPCTQDDKETSANIAE
EFQHGAQGHGRTEKVPPERQPLLNRPYSLDTEIMERVSFYLKRKALDIKLGISLKESVFQ
EPTATDLESESVQEPLGSPRESTLLQGPPTLCHVPVAPDPDKVCLKQPATAVQVVFQEQN
QPSSRAVPHRSARQGSQVHRNMMEAQVHYVQMGTGGEMLNLGEPFSTESQSPGKSKSGYV
PTVAGKRKIPGKPKVVGDLGEGDAGLGFSLVSLKTRQDGEQEKRLLHRQLQGSSLQAQTF
HLEGACPHSPQESPELQFADPPPEVFMETDSEQDMEDSQSKESIVPEPARTAKAPQPMLS
RASQGLPFPRSPTQRKPSQGQPGPGHVPPGHATPASPYTRPSRLPEAGLKNKMKLFFHSI
KLKMKSKAHTEPSTVSTPGKVAKTSKENIDRGLPQAKSPTKKTKPEDFRGPKAQFSVVGP
CLTPSYILDSKFWPRPRRVGSVSVLGHSYHCPRHCPRLAYANQQRNPP
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcactatgtgctttctgtgggacactgaatgtcccttgtatgtctatttctgc
ttcttcatcattgtcctaattgtctggcaagtgcgtcagaattaccaaggattgaagtgc
gaaaatagaagaagctgctgtcggcgtcatcaaaaagtcaggcaaagggctaaagatgca
gcgtcaagagccaggagactttcccgagaagaagatgagaagccatgcgagctgctctct
atcatgaaaagccaaagctgggtccccaagcagggaaatgtgcggcagctcctgtgttta
gatcccagctgccaaatctgtgaggctacgactctagagattcggcagttgctgcagagt
aagaaaagccagatctcccctgccttgttgggactgccacagagagccgcttgcctggag
atgcccatatccagtgagtcttttgaatggaatcaggatttttactccaggtactccaca
aactctccagtggtgcctggaaaccaaacactcacacagctaacagaagagttaacagag
tctaccaatgcagatggtgtcctgctttgctggactgatcccctccagataggacaggaa
tttcatctggcagacatgcccatggcctctgagacactggtttctccagggcttgaggag
ccagtggttttaatgaatgaggaagacacagtgcacagcaatttaaactatatccagcag
ctccaagaccatgaggcattgaactcacagattccttttcagaccctgaccccacagctt
actgtcacacatcctatggctgtgtcgattgtcaccgatgccccgcagccattcctcagt
ccggaagtattaaggcttttggagatacatgtgaaaaaactgatgcatttccaaaggtgg
gggctccccagacgtgtagaggagtccctaaagcaattcatgccaaacccaccagtgtat
ctcccgccagaacataaccaaccagtttcatttatcctgaatactagctctcaagactgt
gttcataggtttgagggtatttcgcccgagacctggtactcatatatggatggacaacct
atccagaccttttgggtttctgagtggtctagtggtgaccaaggacaaagactatcctgc
aaaccaatccctagccctgtggaaaagcccttactcactcctgactatgaacttttacat
gacctctgtctatcgcctgagggacaagttgatggctcccagagcaatcttcagaagaaa
ttcactcagttattctgcggtctcccttctatgcatagtgaatccttggggtccaccttc
ttgtgcactcaaggtgtctccaagaatacactcaaacccccctacaaagagcctcatttc
ttgaaggtgtccccacctattcccttacctgaggcagccccgcccccttcttcaacttct
ccaaatgagtctttggatgagcctcaaagagctcagatcggtggtgttccatttctgact
ctgtcagaatgtaaaactttggagtggcatcttctacaaagacagcttcagcttcagtgg
ggcctgccggctgtcatcgctagacctccacgtgtgcagagccacacgcagtataagcat
aagccatggaataaagccaagccacgtgagactttaaaatttttcgggccaggaaaaccc
ttctcagctctcaccagagagcttttcttcatccctcagcacgctcgcaggctgctggaa
ttccacctgcagaagcggctgattcaccttcgctgggggctgccccagaggatccagcgc
tccataaatatgctgctctcctcaacagacctgcagtccctgccctgcggtggcagtagg
ctacctaatgtgagcatctcacagccagggaaaccagaggcctatgggtctggtgatacg
ttcttacccacagcgggcaaaggaacaacccccatgccacacttgtttgccaaggcacag
gaaatgttgaaaagccatgataccaaatgtgaacagatccgggagggcaaggtcccggcc
tgtgtccaaagcgcctggaaaggcagaattcctggggatttggcagcagggactttattc
ccaaacattccacaaggtcagcccctggagcttcaggcagaaaacaaccctgacctacat
caagaagctgtttcctggaaaccaatggaccttgaccaggaggctcaggccttttcaggt
gttttcattgaacactgtaggcgaccccaagccctgtctgaggaaaccattaagaaactg
gagacaactctgagacataagtatttggccttcctgtcaggcctgcaggccctttactgc
atggccccaactaaagcaacatccccaactgttgaccaatctgtaatcacaactatgccc
tggtctgtcaaaagcccacagaagcccctatctcagaagtctccacttgaagccctatgc
ctgagtgggcttgagccctgtactcaagatgacaaggagacttctgcaaacattgcagaa
gagttccagcatggagctcaggggcatggaaggacagagaaggtgcctccagagagacag
cctctcctgaatagaccctactcattagacacagagatcatggagagagtgagtttctac
ctgaaaaggaaggctctggatataaagttgggaatttctctaaaagagagtgtgttccaa
gagccaactgcaacagacttggagagtgaatctgttcaggagcctctcgggagtccacgg
gaaagcacactgctacagggaccgcccaccttatgtcacgttcctgtagccccagatcca
gataaggtctgccttaaacagccagctactgcagtgcaggttgtgtttcaggagcaaaac
caaccgagttccagagcagtgccccatagatctgcccggcagggctcacaagtccacagg
aatatgatggaggcccaagtgcactatgttcagatggggaccggtggggaaatgctgaac
ctaggggaaccctttagcactgagtcccaaagcccaggcaagagtaagtcaggctatgtc
cctacagtggcaggcaagagaaaaatcccagggaaacccaaggtcgtgggggaccttgga
gaaggggacgcaggtcttggattttccctggtcagtctaaagacacgccaggatggagag
caggagaagaggctcctgcacagacaactccagggctcctcactacaggcccaaaccttt
catcttgagggtgcctgtccacacagcccccaggagtcccctgagctccagttcgcagat
ccacctccagaagtcttcatggagacagactctgagcaggacatggaagacagtcaaagc
aaggaatccattgtcccagaacctgcgaggactgctaaagccccccagcctatgctctcc
cgggcttcccagggccttcctttcccacgctcaccaactcagagaaagccttctcagggc
caacctggtccaggtcacgtcccaccagggcatgcaacgccagcctctccctacacgaga
cccagccgccttccagaggctggcttgaaaaataaaatgaaattattttttcattcaatt
aaactcaagatgaagagcaaagcacacacggagccatccacggtctctacacctggaaag
gtggccaaaaccagtaaagaaaatattgataggggtctgcctcaagccaagagccccacc
aagaaaacaaagccagaggacttcagagggcccaaggcccagttttcagtagttggcccc
tgtctaactccttcctatattctagacagtaagttctggcctcgacctcgacgagttggc
tctgtctcagtactaggccactcttaccattgccctcggcactgtcctaggttggcttat
gccaatcaacagagaaacccaccctag

DBGET integrated database retrieval system