KEGG   Mus musculus (mouse): 100929Help
Entry
100929            CDS       T01002                                 

Gene name
Tyw1, AW125391, Rsafd1
Definition
(RefSeq) tRNA-yW synthesizing protein 1 homolog (S. cerevisiae)
  KO
K15449  tRNA wybutosine-synthesizing protein 1 [EC:4.1.3.44]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    100929 (Tyw1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.44  tRNA 4-demethylwyosine synthase (AdoMet-dependent)
     100929 (Tyw1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    100929 (Tyw1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM Wyosine_form Flavodoxin_1
Motif
Other DBs
NCBI-GeneID: 100929
NCBI-ProteinID: NP_001015876
MGI: 2141161
Ensembl: ENSMUSG00000056310
Vega: OTTMUSG00000027917
UniProt: Q8BJM7
Position
5; 5 G1.3
AA seq 721 aa AA seqDB search
MGPLDVWDLSPLLSLWMNRFYIYMGCALGLTLCICVQIIKKQVTRSQEKRVPGAPDSSLS
PQKKQTHVSGVKIFYGSQTGTAKGFAVVLAKAVTSLDLPVAIINLKEYDPDDSLIGEITS
KTVCAFLVATYTDGCPTESAEWFCKWLEESANDFRFGKTYLKGLRYAVFGLGDSAYRSHF
NKVSTNVDKWLWMLGAQRVLTRGEGDCNAVQSKHGSIEADFTAWKTKFISRLQALQRGEK
KACGGNCKRGKCESAQHGPGEARPHPQGELHPGDAEEEEPCESSSEDELGTQDYQSLTSV
VDVEDLGNIMNPVKREKREKSHQDGKAAMQRNPEKTEDGEGRAMITPALREALTKQGYQL
IGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMEATPSLACANKCVFCWRHHTNPV
GTEWRWKMDQPELILKEAIENHQNMIKQFKGVPGLKAERFEEGMEVKHCALSLVGEPIMY
PEINRLLKLLHQHGISSFLVTNAQFPEEIRKLTPVTQLYVSVDASTRDGLKKIDRPLFKD
FWQRFLDSLKALSAKQQRTVYRLTLVKCWNVDELQAYAELVSLGNPDFIEVKGVTYCGES
AASSLTMANVPWHEEVVRFVRELVDLLPDYEVACEHEHSNCLLIGHKKFKIDGEWWTWIN
YSRFQELVLQYEESGGSKTFSSRDYMARTPQWALFGARERGFDPKDTRYQRKNKTKDISG
C
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctctggatgtgtgggacttgtcgcctttgctgtcactgtggatgaacaggttc
tacatatatatgggctgtgccctgggccttaccctttgcatctgtgtccagatcatcaag
aagcaggtcactcgttcccaggagaaacgtgtcccaggagctcctgatagctccctctcc
cctcagaagaagcagacacacgtttctggagtgaagattttttacggatctcagacgggc
actgccaagggatttgcagtggttcttgccaaagctgtcacctctctggacctgcctgtg
gccattattaatctgaaggaatatgatccagatgacagtctgataggagagatcactagt
aaaaccgtctgtgccttcctggtcgctacgtacacggacggctgccctacagagagtgca
gagtggttctgcaagtggttagaggaatcagctaatgatttccgctttggcaaaacttac
ctgaagggacttcgctatgcagtgtttggcctgggagactctgcctaccggagccacttc
aacaaggtcagcacgaacgttgacaaatggctctggatgctcggtgcccagcgggtgctg
acccgaggggaaggcgactgcaatgcagttcagagcaaacatggcagcatcgaggccgac
ttcacagcctggaagaccaagttcatctcccggctgcaggccctgcagagaggggagaaa
aaggcttgtggcgggaactgcaagagagggaagtgtgagtcggcccagcatggcccagga
gaggcgcggcctcacccgcaaggcgaattgcatcctggggatgctgaggaggaagagccc
tgtgagagcagcagcgaggacgagctcgggacccaggattatcagagcctgacttctgtg
gtggatgttgaggacctgggcaacatcatgaaccccgtgaagagggaaaagagagaaaag
tctcatcaggacgggaaagctgccatgcagaggaacccagagaagactgaggacggcgaa
ggaagagctatgataacacctgctctgcgggaagccctgactaaacaagggtaccagctg
attggcagccactctggtgtgaagctttgcaggtggacaaagtcgatgctgcgggggaga
ggaggttgctacaaacacacattctacggcattgagagccaccgctgcatggaagccacc
ccaagcttggcgtgtgcgaataaatgtgtcttctgctggcggcaccataccaatcctgtg
ggcactgagtggcggtggaagatggaccagccagaattgatcttgaaggaagccattgag
aaccatcagaacatgattaaacagttcaaaggcgtgccaggcctcaaggcggagcgcttt
gaagaggggatggaggtcaagcactgtgcgctgtcactcgtgggtgagccgatcatgtac
ccagaaatcaacaggcttttgaagctgctccaccagcacggcatctccagcttccttgtc
accaatgcgcagttccctgaggagatcaggaagctcacaccagttactcagctctacgtg
agcgtggacgccagcaccagagacggcctgaagaagatcgaccgcccgctcttcaaggat
ttctggcagcgcttcctagacagtttgaaagccttatctgcaaagcaacaacgaacggtc
tacagactgacgcttgtgaagtgttggaacgtggatgaactccaggcctacgctgagctg
gtgtccttggggaaccccgacttcatcgaggtcaagggtgtgacctactgtggtgagagt
gcagccagcagcctcaccatggccaatgtcccttggcacgaggaagtggttcggtttgtc
cgtgagctggtcgatctgcttcccgactatgaagttgcgtgtgaacacgagcactccaac
tgcctcctgatcggacacaagaagtttaagatcgatggagaatggtggacatggatcaat
tacagccgcttccaagagctcgttctgcagtacgaagagagtggaggctccaagacgttc
agctcgagggattacatggccagaaccccacagtgggcactgtttggtgccagggaaaga
ggctttgatcccaaggacacgagataccagaggaagaacaaaacgaaggacatttccgga
tgttga

DBGET integrated database retrieval system