KEGG   Mus musculus (mouse): 101023
Entry
101023            CDS       T01002                                 

Symbol
Zfp513, AW990386, D430028M17Rik, Znf513
Name
(RefSeq) zinc finger protein 513
  KO
K24373  zinc finger protein 513
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    101023 (Zfp513)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    101023 (Zfp513)
SSDB
Motif
Pfam: zf-H2C2_2 zf-H2C2_5 zf-C2H2 zf-C2HE zf-C2H2_4 OrsD GAGA
Other DBs
NCBI-GeneID: 101023
NCBI-ProteinID: NP_780520
MGI: 2141255
Ensembl: ENSMUSG00000043059
Vega: OTTMUSG00000022493
UniProt: Q6PD29
Position
5:complement(31356325..31360007)
AA seq 541 aa
MPRRKQSHPQPVKCEGVKVDTEDSFDEGPGALVLESDLLLGQDLEFEEEEEEDEGDGHND
QLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESEVEEPARGPGEARGERPGPAC
QLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFRC
GRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHTGPPTPPCPTCG
FRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGGASFLPDCGQLRGEGESLC
GTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGVATGGPQGPGDKGF
ACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCPL
CPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAYT
TGHWDNYKRHQKVHGHGGAGGPGLSAPEGWAPPHSPPSVLSTRGPAALGATGSRALHSDS
P
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgccccgaaggaagcaaagccatccacagcccgtgaaatgcgagggggtcaaagtggat
actgaagattccttcgacgaaggtcctggggccctggtgttggagagcgatttgctacta
ggccaagatctggagtttgaagaggaagaggaagaggatgaaggtgacggccacaacgac
cagctcatgggctttgagagagactctgaaggagactctcagggggccagacctggactt
ccctatgggctgagtgacgacgagtctgggggcggccgcgcactaagtgcggagagtgaa
gttgaggaaccagccaggggtccaggggaggccaggggtgagaggccaggcccagcctgt
cagctgtgtggggggccgacaggtgaggggccgtgttgtggggcaggagggccgggtggg
gggcccccgctgcccccacggctactgtactcatgccggctgtgcgccttcgtgtcccac
tactcgagccacctgaagcggcacatgcagacacacagcggggagaagccgttccgctgt
ggccgctgcccctacgcctcagcccagctcgtcaacctgacgcgacatacccgcacccat
actggcgagaagccctaccgctgtccccactgcccctttgcctgcagcagcctgggcaac
ctgaggcggcatcagcgcacccacacagggcctcccactcctccctgcccaacctgtggc
tttcgatgctgtgctccacgaccaacccggcctcccagtcccacagagcaggaggggaca
atgccccgacgatcagaagatgcgctgatcctgccagacttgagtcttcatgtgccacca
ggtggtgccagtttcctgccagactgtgggcagctgcggggtgaaggggagagcttgtgt
ggaactggatccgaaccactgccagagctactgttcccttggacctgccggggctgtgga
caggaactggaggagggtgagggcagcaggctgggagctgccatgtgtgggcgctgcatg
cgaggagaggctggaggggttgccactgggggaccccagggccctggtgacaaaggcttt
gcctgtagtttatgcccctttgccactcactaccccaaccacctggctcggcacatgaag
actcacagtggtgagaaacccttccgctgtgcccgctgtccatacgcctctgctcatctg
gataacctgaaacggcaccagcgcgtccacacaggagaaaagccctacaagtgccccctc
tgtccgtatgcctgtggcaacctggccaacctcaagcgtcatggtcgcatccactctggt
gacaaaccttttcggtgtagcctttgcaactacagctgcaaccagagtatgaacctcaaa
cgtcatatgctgcgacacacgggcgagaagcccttccgctgtgccacctgcgcctatacc
acaggccactgggacaactacaagcgtcatcagaaggtgcatggccatggtggagcagga
gggcctggtctctctgcccctgagggctgggccccacctcatagcccaccctctgttttg
agcactcggggtccagcagccctgggtgctactggtagcagggctcttcattcagactca
ccttga

DBGET integrated database retrieval system