KEGG   Mus musculus (mouse): 101206
Entry
101206            CDS       T01002                                 

Symbol
Tada3, 1110004B19Rik, AD, ADA3, AI987856, Tad, Tada3l
Name
(RefSeq) transcriptional adaptor 3
  KO
K11315  transcriptional adapter 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101206 (Tada3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    101206 (Tada3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    101206 (Tada3)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101206 (Tada3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     101206 (Tada3)
    STAGA complex
     101206 (Tada3)
    TFTC complex
     101206 (Tada3)
    SAGA complex
     101206 (Tada3)
    SLIK complex
     101206 (Tada3)
    ADA-HAT complex
     101206 (Tada3)
    HAT-A2 complex
     101206 (Tada3)
    ATAC complex
     101206 (Tada3)
SSDB
Motif
Pfam: Ada3
Other DBs
NCBI-GeneID: 101206
NCBI-ProteinID: NP_598693
MGI: 1915724
Ensembl: ENSMUSG00000048930
Vega: OTTMUSG00000023740
UniProt: Q8R0L9
Position
6; 6 E3
AA seq 432 aa
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRR
LRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKTGHGPGPGPGR
PKSKNVQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPP
EDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLIGPLTELDTKDVDAL
LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPR
NQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHN
RTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTL
KERESILKLLDG
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcgagctgaaggactgtccactgcagtttcatgacttcaagtctgtggaccacctg
aaggtctgtccccgctacacggcagtgctggcccgctccgaggacgatggcattggcatt
gaggagctggacaccctgcagctggagcttgagactctgctgtcctctgcaagccggaga
ctgcgtgtactggaagctgaaacccagatccttactgactggcaggataagaaaggggac
cgacgattcctgaagctaggtcgcgaccacgagctcggtgctccccccaaacacggaaag
cccaagaagcagaaactggaagggaagacaggacatgggccaggccctggcccgggacga
cccaaatccaaaaacgtccaacccaagatccaggaatatgaatttactgatgacccaatc
gacgtgcctcggatccccaagaatgatgctcccaacaggttctgggcctctgtggagccc
tattgtgccgacatcaccagtgaggaggtacggacactagaggagctcctgaagccccca
gaagatgaagctgaacattataagattccccccctagggaaacactactcccagcgctgg
gcccaggaggatctgctggaggagcagaaggacggcgctcgggcagcagctgtggctgac
aagaagaaaggcctcataggaccactgacagaactggacacaaaagatgtggatgccctg
ctgaagaagtctgaggcccagcatgaacagccagaagacgggtgtccctttggagccctg
acacagcgcctgctgcaggccctagtggaggaaaatattatctcccctatggaggactcc
cctattcctgacatgtctgggaaagagtcaggggcagatggagcgagcacctccccgcgc
aatcagaacaagcctttcagtgtgccacataccaagtccctggagagccgcatcaaggag
gagctgattgcccagggcctcctggagtctgaggaccggcccgcggaggactcagaggac
gaggtccttgctgagctgcgcaaacggcaagctgagctgaaagcactcagtgcacacaac
cgcaccaagaagcatgacctgctgaggctggcaaaggaggaggtgagccggcaggagcta
aggcagcgggtccgcatggccgacaacgaagtcatggatgccttccggaagatcatggct
gcccggcagaagaagcgcacccctacaaagaaggaaaaggaccaggcctggaagaccctg
aaggagcgggaaagcatcctgaagctcctagacgggtag

DBGET integrated database retrieval system