KEGG   Mus musculus (mouse): 101314
Entry
101314            CDS       T01002                                 

Gene name
Brk1, 6720456B07Rik, AW011779
Definition
(RefSeq) BRICK1, SCAR/WAVE actin-nucleating complex subunit
  KO
K05752  chromosome 3 open reading frame 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04810  Regulation of actin cytoskeleton
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101314 (Brk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101314 (Brk1)
SSDB
Motif
Pfam: CCDC53 MerR-DNA-bind SPX
Other DBs
NCBI-GeneID: 101314
NCBI-ProteinID: NP_598698
MGI: 1915406
Ensembl: ENSMUSG00000033940
Vega: OTTMUSG00000056403
UniProt: Q91VR8
Position
6; 6 E3
AA seq 75 aa
MAGQEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERR
IEYIEARVTKGETLT
NT seq 228 nt   +upstreamnt  +downstreamnt
atggcgggacaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag
tacattgagatcatcaccagcagcatcaagaaaatctcagactttctcaactctttcgat
atgtcttgtcgttcaagactcgcaacactaaatgagaaattgacagcccttgaacggaga
atagagtacattgaagcgagggtgacaaagggtgagactctgacctag

DBGET integrated database retrieval system