KEGG   Mus musculus (mouse): 101488
Entry
101488            CDS       T01002                                 

Symbol
Slco2b1, AI060904, AI852653, OATP-B, Slc21a9
Name
(RefSeq) solute carrier organic anion transporter family, member 2b1
  KO
K14352  solute carrier organic anion transporter family, member 2B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    101488 (Slco2b1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   101488 (Slco2b1)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2
Other DBs
NCBI-GeneID: 101488
NCBI-ProteinID: NP_001239460
MGI: 1351872
Ensembl: ENSMUSG00000030737
Vega: OTTMUSG00000024669
UniProt: Q8BXB6
Position
7; 7 E1
AA seq 683 aa
MPDRSTKTTMGTEDMHERKVSVEPQDSHQDAQPRGMFHNIKFFVLCHSLLQLTQLMISGY
LKSSISTVEKRFGLSSQISGLLAAFNEVGNVSLILFVSYFGSRVHRPRMIGYGALLVATA
GLLMALPHFISEPYRYDHSSSDNRSLDFEASLCLPTTMAPASALSNGSCSSHTETKHLTM
VGIMFAAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYIGILFGITTMGPGLAYGLGSLM
LRLYVDIDRMPEGGINLTPKDPRWVGAWWLGFLISSGLVVLASSPYFFFPREMPKEKHEF
HFRRKVLASAASTASKGEDLSSQHEPLKKQAGLAQIAPDLTLVQFVKVFPRVLLRNLRHP
IFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLVIVGIMMGGVL
VKRLHLSPVQCSALCLLGSLLCLLFSVPLFFIGCSTHQIAGITQDLGAQPGPSLFPGCSE
PCSCQSDDFNPVCDTSAYVEYTTPCHAGCTGRVVQEALGKSQVFYTNCSCVAGNGTVPAG
SCESACSRLVLPFIVLFSLGAGLASITHTPSFMLILRGVKKEDKTLAVGMQFMLLRVLAW
MPSPVIHGSAIDTTCVHWALTCGRRAVCRYYDHDLLRNRFIGLQFFFKSGSLVCFTLVLA
ILRQQSREASTRTTVKSSELQQL
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgccagacaggagcaccaagaccacaatgggcacagaagatatgcatgaaaggaaagtc
agtgtggagcctcaggactcacatcaggatgcacagccccgcgggatgttccacaacatc
aagttctttgtcctatgtcacagtctactgcagctgacacagctcatgatctctggctac
ctcaagagctccatctccacagtggaaaagcgctttgggctgtccagccagatctcaggg
ctgctagctgctttcaatgaggtagggaatgtatccttgatcttatttgtgagctatttc
ggcagccgagtgcacagaccccggatgatcggctatggggctctcctggtggccacggca
ggcctgctcatggcactccctcacttcatctcagaaccataccgctatgaccacagcagc
tccgacaataggtcactggactttgaagcatccctgtgcctgcccacgactatggctcca
gcctctgccctgtccaatggcagctgttccagtcacacagaaaccaagcatctgaccatg
gtggggatcatgttcgcagcacagaccctgcttggcatcggtggtgtgcccatacagcct
tttgggatctcctacattgacgactttgcccaccatagcaactcacccctctacattggg
atcttgtttggaataaccacgatggggcctggcctggcctatgggctgggtagcctcatg
ctacgcctttatgtggacattgaccggatgccagaaggaggcatcaacttgactccaaaa
gaccccagatgggtgggtgcctggtggctgggcttcctcatctcttcaggactggtggtc
ctggcttccagcccctacttcttcttccccagagagatgcccaaggagaaacatgagttt
catttcaggcggaaggtcttggcaagtgcggcctccactgccagcaagggtgaggacctc
tcctcccagcacgagcctttaaagaaacaggctggattggcccagattgccccagacttg
actttggtccagtttgtcaaagtcttccctagggtgctgctgcggaatctgcgccacccc
atcttcttgctggtagtcctgtcccaggtgtgcacctcatccatggtagcgggcatggcc
accttcctgcctaagttcctggaacgccagttttccatcacagcctcctttgccaacatg
ctccttggctgcctcactatccctctggtcatcgtgggcatcatgatgggaggtgtctta
gtcaagcgcctccacctgagcccggtgcagtgcagtgccctctgcctcctcggctcgctg
ttgtgtctgctcttcagcgtgccgctcttcttcattggctgctctacccatcaaattgca
ggcatcacacaagacctgggtgcccagccagggccaagcctgtttcctggctgctcagag
ccctgctcctgccaatcagatgactttaaccctgtttgtgataccagtgcctatgtggag
tacaccacaccctgccatgcaggctgcacaggtcgtgtcgtccaggaggctctgggcaaa
agccaggtcttctacaccaactgcagctgtgtggcagggaatggcactgttcctgcaggt
tcctgtgagtcagcctgcagccgcctggtgctgcccttcattgtcctgttcagcctgggg
gcgggactggccagcatcacccacacaccttccttcatgctcatcctgagaggtgtgaag
aaagaagataaaaccctggcagtggggatgcagttcatgctcctgagagtgctggcctgg
atgcccagccctgtgatccatggcagtgccatcgataccacctgtgttcactgggccctg
acctgtgggcggagagctgtctgccgctactacgaccatgacctgctccgaaaccgattc
ataggcctccagttcttcttcaaaagtggatccctggtgtgctttaccttagttttggcc
atcttgaggcaacagagcagagaggccagcaccaggaccactgtaaagagctcggaacta
caacagctataa

DBGET integrated database retrieval system