KEGG   Mus musculus (mouse): 101533Help
Entry
101533            CDS       T01002                                 

Gene name
Klk9, 1200016C12Rik, AI324041
Definition
(RefSeq) kallikrein related-peptidase 9
  KO
K09618  kallikrein 9 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    101533 (Klk9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101533 (Klk9)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101533 (Klk9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Pico_P2A
Motif
Other DBs
NCBI-GeneID: 101533
NCBI-ProteinID: NP_082936
MGI: 1921082
Ensembl: ENSMUSG00000047884
Vega: OTTMUSG00000058310
UniProt: Q32M27
Position
7 B3; 7 28.26 cM
AA seq 251 aa AA seqDB search
MKLGLTLVLFSLLAGHCGADTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLT
AAHCRKPYLWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRK
VRLTPAVQPLNLTESRPPVGTQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYP
GHISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDY
LEWIESTMEKN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggactcaccttggtgctgttctctctgctggcaggccactgtggagctgac
acccgtgccgtcggagcccgggaatgcgtacgcaactctcagccctggcaggctggcctc
ttctacctcacccggcagctctgtggagccacgctcatcaatgatcaatggctgctcaca
gctgctcactgccgaaagccgtacctgtgggtccgcctcggggagcatcatctgtggcgg
tgggagggccctgagcagctgcttctggtcacagacttcttcccccatcctgggttcaat
ccagatctctctgccaatgaccacaatgatgatattatgctgatccggctacctcggaag
gtccggctgactccagctgtgcaacccctcaacctcaccgagagccggccacctgtgggc
acccagtgccttatctctggctggggcagtgtgtcaagctccaaattacagtatccaatg
acactgcagtgtgccaacattagcattctggacaacaagctctgccgctgggcatacccg
ggccacatctctgagaagatgctgtgcgctggcctgtgggagggtggccgaggctcttgc
cagggtgactctgggggacccctggtgtgcgaaggaaccttggcaggtatagtgtctgga
ggatctgagccttgttccagaccccggagacccgctgtctacactaacgtctttgactac
ctggagtggattgaaagcaccatggaaaaaaactga

DBGET integrated database retrieval system