KEGG   Mus musculus (mouse): 101543
Entry
101543            CDS       T01002                                 

Symbol
Wtip
Name
(RefSeq) WT1 interacting protein
  KO
K16682  LIM domain-containing protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101543 (Wtip)
   04392 Hippo signaling pathway - multiple species
    101543 (Wtip)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    101543 (Wtip)
   03036 Chromosome and associated proteins [BR:mmu03036]
    101543 (Wtip)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101543 (Wtip)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101543 (Wtip)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 101543
NCBI-ProteinID: NP_997095
MGI: 2141920
Ensembl: ENSMUSG00000036459
Vega: OTTMUSG00000008381
UniProt: Q7TQJ8
Position
7; 7 B1
AA seq 398 aa
MQRSRTAADDAALLLAGLGLRESEPTAGSPGRVRRGPRAVDEAAPASGRRGKGGCGGPEA
APDVPSRPERGPRASLAGSDGGSARSSGISLGYDQRHGPGPGPPSGGSARSSVSSLGSRG
SAGACADLLPPGVGPAPARSPEPAQFPFPLPSLPLPPGREGGPSAAERRLEALTRELERA
LEARTARDYFGICIKCGLGIYGARQACQAMGSLYHTDCFICDSCGRRLRGKAFYNVGEKV
YCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDV
DNNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVECYHCEDCGLQLSG
EEGRRCYPLEGHLLCRRCHLRRLGQGPLPSPAVHVTEL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgcagcgctcgcggacggccgcggacgacgcggctctgctcctggccgggctgggcctg
cgcgagtcggagccgaccgccggctccccagggcgcgtgcggcgcgggccgagggccgtg
gacgaggcggcgccagcgtcgggccgccgaggcaagggtggctgcggcggccccgaggcc
gcgcccgacgtcccgagccgccccgagcgaggcccgcgcgccagcctcgcgggctcggac
ggcggcagcgcgcgctcgagcggtatcagcctgggctatgaccagcgccacggccccggc
cccgggccgccgtcggggggcagcgcgcgctccagcgtgtccagcctgggttcccgtggc
tcagcgggcgcctgtgcagacctgctgccgcccggcgtcggcccggcgcccgcccgctct
ccggagcctgcccagttccccttcccgttgccgtcgctgccgctgcccccgggccgggag
ggcggcccgagtgcggccgagcggcggctggaggcgctcacgcgggaactggagcgcgcg
ctcgaggcgcgcacggcgcgagactactttggcatttgtatcaagtgtggccttggcatc
tacggagcgaggcaggcgtgccaggcgatggggagcctgtatcacaccgactgcttcatc
tgtgactcctgtgggagacggctccgtgggaaggccttctataacgtgggtgagaaagtg
tactgccaggaggacttcctgtactccgggttccagcaaacagctgacaagtgtagcgtg
tgtggacacctcatcatggagatgattctgcaggcccttggcaagtcctaccacccaggc
tgcttccgctgctcagtgtgcaacgagtgcttggatggggttcccttcactgtggatgtg
gacaacaacatttactgcgttagagactatcatacggtgtttgcaccaaaatgtgcctcc
tgtgcccgtcccatcctccctgcacagggctgtgagacaaccattcgtgtggtgtccatg
gacagagactaccatgtggagtgttaccactgtgaggactgtgggctgcagctgagtggg
gaggagggacgccgctgctatcccctggaggggcacctgctctgccggcgatgccacctg
aggcgccttgggcagggcccgctcccctcgcctgctgtgcatgtgactgagctctga

DBGET integrated database retrieval system