KEGG   Mus musculus (house mouse): 101568
Entry
101568            CDS       T01002                                 
Symbol
Vrk3
Name
(RefSeq) vaccinia related kinase 3
  KO
K08816  vaccinia related kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    101568 (Vrk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101568 (Vrk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  VRK family
   101568 (Vrk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr zinc_ribbon_2 zf-ribbon_3 DZR UPF0547 zinc_ribbon_15 DZR_2
Other DBs
NCBI-GeneID: 101568
NCBI-ProteinID: NP_598706
MGI: 2182465
Ensembl: ENSMUSG00000002205
UniProt: Q8K3G5 Q3TAR6
Position
7:44398049..44426939
AA seq 453 aa
MISFCPVCGKSVKVSFKFCPYCGKALPVEEDGGTQSAVTPHVSSVPGSRRDLNSSFETSP
KKVKCSHTVTSLPLSRHSDCDSSGSDNTLTSPDRATGTRSRPLTPKGSPLSNRQSPQTLK
RTRVTTSLQALATGTELTDQNGKHWTLGALQIRDDQGILYEAEPTSAVPSESRTQKWRFS
LKLDSKDGRLFNEQNFFQRVAKPLQVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPS
LGRSLQSALDDNPKHVVSERCVLQVACRLLDALEYLHENEYVHGNLTAENVFVNPEDLSQ
VTLVGYGFTYRYCPGGKHVAYKEGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCML
KWLYGSLPWTNCLPNTEKITRQKQKYLDSPERLVGLCGRWNKASETLREYLKVVMALNYE
EKPPYATLRNSLEALLQDMRVSPYDPLDLQMVP
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgatctccttctgtccagtctgtggcaaaagtgtcaaggtatcattcaagttctgccct
tactgtggcaaggccctgcctgtagaggaggatggaggcacccagtctgccgtgacgcct
catgtgtcatccgttccaggctccaggagagacctgaactccagttttgaaacctctccc
aagaaagtgaaatgctcacacactgtcacttctctcccactctcccgccactctgactgt
gacagttctgggtcagacaacaccttgacttctcctgacagggccacaggcacccggagc
agacccctgacccccaaaggcagcccactttccaacaggcagagccctcagactctgaag
cggacccgggtgaccacctcactccaggctctagccacaggaacagagctgacagaccag
aatgggaaacactggaccctgggggccctgcagatccgggatgaccaaggcattctctat
gaagctgagcctacttctgccgtcccctctgaatcaaggacccagaagtggagattctca
ctcaaactggactccaaggatgggcgccttttcaatgagcagaacttctttcagagagta
gccaagcctctgcaagtgaacaaatggaagaagcagttcttgctcccgctcctggccatc
cccacctgtatcggctttggcattcaccaggacaagtacaggttcctagtattccccagc
ctggggaggagccttcagtcagccctggatgacaacccaaagcatgtggtatcagagaga
tgtgtgcttcaggtggcctgcaggctgctggatgctctggagtatctccatgaaaatgag
tatgttcacgggaacctgacagctgagaatgtctttgtgaatccagaggatctgagccag
gtgaccctggtgggctatggcttcacctaccgatactgcccaggtggcaaacacgtggcc
tacaaagaaggcagcaggagtccacacgatggggacttggagttcattagcatggacctg
cacaagggatgcggaccctcccgccgcagcgatctccagaccttgggctactgtatgctc
aagtggctttatgggtccctgccatggacaaattgccttcccaacaccgaaaagataact
aggcagaagcagaagtatctggacagccccgagcgcctcgtgggactgtgtggccgctgg
aacaaggcctcagagaccctgcgggagtacctgaaggtggtgatggccctcaattatgag
gagaagccaccctatgccacgctgaggaacagcctagaagctctgctgcaggatatgcgg
gtgtcaccctatgaccctctggacctccagatggtgccttag

DBGET integrated database retrieval system