KEGG   Mus musculus (mouse): 101613
Entry
101613            CDS       T01002                                 

Symbol
Nlrp6, AI504961, Avr, N, Nalp6, Navr, Navr/Avr, Non-AVR, Pypaf5
Name
(RefSeq) NLR family, pyrin domain containing 6
  KO
K20863  NACHT, LRR and PYD domains-containing protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101613 (Nlrp6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    101613 (Nlrp6)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101613 (Nlrp6)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 DUF3764 NB-ARC
Other DBs
NCBI-GeneID: 101613
NCBI-ProteinID: NP_598707
MGI: 2141990
Ensembl: ENSMUSG00000038745
Vega: OTTMUSG00000044619
UniProt: Q91WS2
Position
7; 7 F5
AA seq 869 aa
MDAAGASCSSVDAVARELLMATLEELSQEQLKRFRHKLRDAPLDGRSIPWGRLERSDAVD
LVDKLIEFYEPVPAVEMTRQVLKRSDIRDVASRLKQQQLQKLGPTSVLLSVSAFKKKYRE
HVLRQHAKVKERNARSVKINKRFTKLLIAPGTGAVEDELLGPLGEPEPERARRSDTHTFN
RLFRGNDEESSQPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYHSQVDFAFFMPCGELLE
RPGKRSLADLVLDQCPDRAWPVKRILAQPNRLLFILDGADELPTLPSSEATPCKDPLEAT
SGLRVLSGLLSQELLPGARLLVTTRHAATGRLQGRLCSPQCAEIRGFSDKDKKKYFFKFF
RDERKAERAYRFVKENETLFALCFVPFVCWIVCTVLQQQLELGRDLSRTSKTTTSVYLLF
ITSMLKSAGTNGPRVQGELRTLCRLAREGILDHHKAQFSEEDLEKLKLRGSQVQTIFLNK
KEIPGVLKTEVTYQFIDQSFQEFLAALSYLLEAERTPGTPAGGVQKLLNSDAELRGHLAL
TTRFLFGLLNTEGLRDIGNHFGCVVPDHVKKDTLRWVQGQSHPKGPPVGAKKTAELEDIE
DAEEEEEEEEDLNFGLELLYCLYETQEEDFVRQALSSLPEIVLERVRLTRMDLEVLNYCV
QCCPDGQALRLVSCGLVAAKEKKKKKKSLVKRLKGSQSTKKQPPVSLLRPLCETMTTPKC
HLSVLILSHCRLPDAVCRDLSEALKVAPALRELGLLQSRLTNTGLRLLCEGLAWPKCQVK
TLRMQLPDLQEVINYLVIVLQQSPVLTTLDLSGCQLPGVIVEPLCAALKHPKCSLKTLSL
TSVELSENSLRDLQAVKTSKPDLSIIYSK
NT seq 2610 nt   +upstreamnt  +downstreamnt
atggatgccgctggagcctcctgctccagcgtggatgcagtggcaagggagctgcttatg
gctacactggaggagctgagccaggagcagctgaagcgcttccgccacaagctaagggat
gcgcccctggatggccgcagcatcccgtgggggcgactggagcgctcagacgctgtggac
cttgtcgacaagctcattgagttctatgagccagtgccagctgtagaaatgacccggcag
gtcctgaagaggtcggatattcgagatgtggcctcgcgacttaagcaacagcagctacag
aagctcggccccacctcggtgcttctctccgtgtcagcgttcaagaagaagtaccgcgag
cacgtgctacgacagcatgctaaggtgaaggagaggaatgctcgctctgtgaagatcaac
aagcgcttcaccaagctgctcatcgctccggggaccggcgctgtggaggacgagctgctg
gggccgttgggggagccggagcccgaacgcgctcggcgctcggacacgcacacttttaat
cggctcttccggggaaatgatgaagagagctcgcagccgctgaccgtggtgctgcagggc
ccggcaggcatcggcaaaaccatggccgccaagaaaatcctctatgactgggcagcaggt
aagctataccacagccaggtggactttgccttcttcatgccgtgcggcgagctgctggag
cggccgggaaagcgcagcttggcggacctggtgctggaccagtgcccggaccgcgcttgg
ccagtgaagcggatactggcgcaacccaatcgcctactgttcatcctggacggtgcagac
gagctgcctactttaccatcctcagaggccactccctgcaaagaccctttggaggctaca
agtggcttgagagtgctgagcgggctgctgagccaggagctgttaccaggagctcgcttg
ctagtgactacacgccatgccgctacagggaggctgcagggcagattgtgctcgccacag
tgcgcagaaatacgcggcttctcagacaaagacaaaaaaaagtatttcttcaagttcttc
cgggacgagaggaaggcagagcgcgcttaccgcttcgtgaaagagaacgagacgctgttt
gcactgtgctttgtgcccttcgtgtgctggatcgtgtgcacagtgctgcagcagcagcta
gagctgggccgggatctctctcgtacctccaagaccactacttctgtgtacctgctcttc
atcaccagcatgctgaagtctgcaggcaccaatggaccccgggttcagggagagctgaga
acgctgtgtcgcctggccagggagggcatcctggatcatcataaagcacaattctcagaa
gaggacctggagaaattgaagcttcggggttcccaagttcagacaatatttctcaacaag
aaagagataccaggagtgctaaaaactgaggtcacctaccagttcattgaccagagcttc
caggagttcttggctgcattgtcatacctactagaagctgagcgaactccggggacgccc
gcaggcggtgtgcagaagctcctgaactctgacgcggagctacgtggtcatcttgcactg
accacccgattcctctttggcctgctaaatacagaggggcttcgtgacattggaaaccat
tttggctgtgtggtgccagatcatgtgaaaaaggacaccctgcggtgggtacaaggacag
agccaccccaaggggccaccagtaggggcaaaaaagactgctgagctggaggacatcgag
gacgcagaggaggaggaggaggaagaggaggacctcaattttggactggagctgctgtac
tgcctgtatgagacacaggaggaggattttgttcgacaggctctcagcagccttccagag
atagtactggagcgagtcaggttgacccgcatggaccttgaagttctgaattactgcgtg
cagtgctgcccagatggccaggctctgagactggtgagctgtgggctggtggcggcaaag
gagaagaagaagaagaagaagagcctggtgaagcggctgaagggctctcaaagcaccaag
aaacaacccccagtctccttgctgcgtccactctgtgagacaatgactaccccgaaatgt
catctgagtgttctgatcttgtcacactgcagactccctgatgcagtttgccgagacctt
tccgaggccctgaaggtagctcctgccctaagggagttgggcctcctccagagccggctc
accaacacaggcctgcgtttactgtgcgaaggcctggcttggcccaagtgccaggtgaag
acactcaggatgcagctgcctgacctccaagaggtgatcaattacttggtcatcgtgctc
cagcagagcccagtcctgaccactctggacctcagtggctgtcagctgcctggcgtcatt
gtggaacctctgtgtgcagccctgaagcaccctaaatgctccctaaagaccctcagtctg
acctctgtggagctgagtgagaactcactgagggatcttcaagctgtgaagacatcaaag
ccagatctgtccatcatatattcaaaataa

DBGET integrated database retrieval system