KEGG   Mus musculus (house mouse): 101631
Entry
101631            CDS       T01002                                 
Symbol
Pwwp2b, AI594893, D7Ertd517e, D930023J19Rik, Pwwp2
Name
(RefSeq) PWWP domain containing 2B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PWWP
Other DBs
NCBI-GeneID: 101631
NCBI-ProteinID: NP_001092106
MGI: 2142008
Ensembl: ENSMUSG00000060260
UniProt: E9Q9M8 Q14AS8 Q3TYY8
Position
7:138828398..138847172
AA seq 600 aa
MEPRAGCRLPVRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLSPSTLLPLADNS
SAVSCHGQAPEEGTGEVMQLETGPLHPHHKDPEKDQPPKTAVSEPPPPLIPPVPAGNLPP
FPPYFEGAPFPHPLWLRNTYQQWVPQPPPRTIKRTRRRLSRNRDPGRLILSTIRLRPRQV
LCEKCKSTVSPQEASPSPLNTPKPRRRLGSGPDSEHRKPEEPEDSAVIATAAPRRSKREK
REEDRVAGERVPRSPVIKISYSTPQGKGEVVKIPSRVHGSVEPFCPQQSLQNGSQDSEVS
RDVEPRGGGDRPPSGSSASIPKLKLTRPVPPISDLPPPKIRLKPHRLGDGEHEPLYRAEL
VEELNGCPRGPLVSSPALFADGSSHGLEDLSSGSSGEDDDLKRFPQGKHGRDGLAFLVDC
PGRRTDCTSESVCSTDSLDELKSSGSEVTSPDTGDLSSGDSASVPSSSADTRQTVPPLTV
RLHTQSVSRCVTEDGRTVAVGDIVWGKIHGFPWWPARVLDISLGQKEDGEPSWQEAKVSW
FGSPTTSFLSISKLSPFSEFFKLRFNRKKKGMYRKAITEAANATQHVAPEIRELLTQFEM
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggagccgcgggccggctgccggttgccggtgcgggtggaacaggtcgtcaacggcgcg
ctggtggtcaccgtgagctgtggcgagcgcagcttcgccggaatcctgctggattgcacg
aaaaagtctggcctctttggcctgtctccatctactctactgcctctggctgacaactcc
tctgccgtcagctgtcatggccaggctcccgaggagggaactggagaagtgatgcagcta
gagacaggacctctgcatcctcaccacaaagaccctgagaaggatcagcctcccaagaca
gctgtgtctgagccgcccccacctctcataccacctgtgcctgccgggaacctgcctccc
tttccaccatactttgagggtgcccccttccctcacccactatggctgaggaacacctac
cagcagtgggtgccgcagcccccacccaggaccatcaagcggacccgtcggcgactctcc
agaaaccgggatcctggaagactcattcttagcacaatccgcctgcggccacgtcaggta
ctgtgtgagaagtgcaagagtactgtgagtcctcaagaggccagtcccagccccctgaac
acccccaaaccccgccggaggctaggcagtggccctgacagtgaacaccgaaagccagag
gaaccagaagacagcgctgtcatagctacagctgccccgaggaggagcaagagggagaag
cgggaagaggacagggttgctggagagcgtgttccgagaagcccagtcatcaagatctcc
tacagcacaccacagggtaagggtgaggtggtcaagattccatccagagtgcatggctcc
gtggagcccttctgcccgcaacagtctctacagaatggcagccaggactcagaggtatca
agggatgtggagcccaggggtggtggagaccgaccacccagcgggtcttcagcctccatc
cccaagctaaagctgactcgcccagtgcctcctatctctgacctgccacctcccaaaatc
cgcctgaagccccaccggctgggggatggagagcatgaacccctttaccgggctgagctg
gtggaggagctgaacggatgcccacgaggcccgctggtcagctcccctgctctctttgcc
gatggctctagccatgggctagaggacttgtcttctggaagttctggtgaggacgatgac
ctcaagaggtttccccaaggtaaacatggccgtgatggcttggcttttcttgtggactgc
cctgggaggagaacagattgtaccagtgaatctgtgtgcagcacggacagcctggatgaa
ttaaaatcatctggttcagaagtgacatctccagacacaggagacctgtcatctggtgac
agtgcctctgttccttcatcttctgctgacactcgccagacagtccctcccctcacggtc
aggctgcacacgcagagcgtctcacggtgtgtgactgaagatggaaggacggtggctgta
ggggacattgtgtggggtaagattcatggttttccttggtggccagcgcgtgtccttgac
atcagccttggccagaaggaggatggagagccctcttggcaagaagcgaaagtctcatgg
tttgggtctccaactacatcattcttgtctatttcaaaactgtcccctttctctgaattt
ttcaaactgagatttaaccgtaagaagaaggggatgtatcggaaagctataactgaggct
gcaaatgccacacaacacgtggccccagaaataagggagctcttgacccagtttgaaatg
taa

DBGET integrated database retrieval system