KEGG   Mus musculus (house mouse): 101772
Entry
101772            CDS       T01002                                 
Symbol
Ano1, Tmem16a
Name
(RefSeq) anoctamin 1, calcium activated chloride channel
  KO
K19496  anoctamin-1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    101772 (Ano1)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   101772 (Ano1)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer DUF2207_C
Other DBs
NCBI-GeneID: 101772
NCBI-ProteinID: NP_848757
MGI: 2142149
Ensembl: ENSMUSG00000031075
UniProt: Q8BHY3 A0A0A0MQF2
Structure
Position
7:complement(144142286..144305762)
AA seq 960 aa
MRVPEKYSTLPAEDRSVHIVNICAIEDLGYLPSEGTLLNSLSVDPDAECKYGLYFRDGKR
KVDYILVYHHKRASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYH
EDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKK
VYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRLSYPFSREKQHLFDLTDRDSF
FDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYSAAYPLHDGDYEGDNVEFNDRKL
LYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATV
DENIPSMEMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLRKESRNKETDKVK
LTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTA
TAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVA
FFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKM
KKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLEPFAGLTPEYMEMIIQFGFVTLFVASF
PLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVIS
FTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKD
YREPPWSEHKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKE
KVLMVELFMREEQGKQQLLDTWMEKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgagggtccccgagaagtactcgacgctcccggcggaggaccgcagcgtccacatcgtg
aacatctgcgccatcgaggacctgggctacctgccgtccgagggcacgttgctgaactct
ctgtccgtggaccccgacgccgaatgcaagtatggactatacttcagggatggcaaacgg
aaggtggactacatcttggtataccatcacaagagagcctcagggagcaggactctggcc
aggaggggactacaaaatgacatggtcctggggacccgcagcgtcaggcaggaccagccc
cttcccgggaaggggagccctgtggatgcaggctcaccggaagtccccatggattaccat
gaagatgacaaacgcttcagacgggaggaatatgagggcaacctgttggaggcaggcctg
gagttggagaatgacgaggataccaaaatccatggtgtcgggtttgtgaagatccatgcg
ccctggcatgtgctctgtagggaagctgagtttttgaaactaaagatgcccacaaagaag
gtgtaccacatcagtgagacgcgaggcctcctgaaaaccatcaactcggttctgcagaag
atcacagaccccatccagcccaaggtggctgagcacaggccacagaccacaaagaggctc
tcctatcccttctcccgggagaagcaacacctattcgacctgactgacagggactctttt
ttcgacagcaaaacccggagcacaatagtctatgaaatcctgaagagaacaacgtgcacc
aaggccaagtacagcatgggtatcaccagcctcctggccaatggcgtatactcagctgca
taccctctgcacgatggggactatgagggtgacaacgttgagttcaacgacaggaaactc
ctgtatgaggaatgggcaagttacggagtcttctacaaataccagcccattgacctggtc
aggaaatactttggtgagaaggttggcctgtactttgcctggcttggagcctacacccag
atgctcatccctgcctcgatcgtgggtgtcattgtctttctctatggatgtgccactgtg
gacgaaaacatccccagtatggagatgtgtgaccagagatacaacatcaccatgtgtcct
ctgtgtgacaagacctgcagctactggaagatgagctcagcctgtgccacagcccgtgcc
agtcacctttttgataaccctgccaccgtcttcttctctgtgtttatggccctctgggct
gccactttcatggagcactggaaacggaagcagatgaggctcaactaccgatgggacctc
acaggcttcgaggaggaggaggaagctgtcaaggatcatcccagagcagagtatgaagcc
agagtcttagagaagtcactgagaaaagaatccagaaacaaagagaccgacaaggtgaag
ctgacctggagggaccgattcccagcctatttcaccaatcttgtctccatcatcttcatg
atcgcagtgacatttgcaatcgtcctcggagttatcatctatagaatctccacagctgca
gccttggccatgaactcctccccgtctgtgcggtccaacatccgggttacagtcacggcc
accgctgttatcatcaacctcgtggtcatcattctgctggatgaagtttacggctgcatt
gccaggtggctcaccaagattgaggtcccaaagacagagaagagctttgaggagaggcta
accttcaaggccttcctgctcaagtttgtgaactcttacactcccatcttctatgtcgcc
ttcttcaaaggccggtttgttggtcggcccggtgactacgtgtacatcttccgctctttc
cggatggaggagtgtgccccgggcggctgcctcatggagctctgtatccagctgagcatc
attatgctgggcaagcagctaatccagaacaatctcttcgagattggcatcccgaagatg
aaaaagttcatccgctacctgaagctgcgcagacagagcccctcagaccgtgaagagtac
gtgaagcggaagcagcgctatgaggtggacttcaacctcgaacctttcgccggcctcacg
cccgagtacatggaaatgatcattcagttcggctttgtcaccctgtttgttgcgtccttc
cctctggctccactcttcgccctgctaaacaacatcattgagatccgcctggatgccaaa
aagtttgtcaccgagctacggaggccagtagccatcagagccaaagacatcggcatctgg
tataacatcctcagaggtgttgggaagctggctgtcatcattaatgcctttgtgatctcc
ttcacgtctgacttcatccctcgcctggtgtacctctacatgtacagtcagaatgggacc
atgcacggcttcgtcaatcacacgctctcttccttcaatgtcagcgacttccagaatggc
acagcacccaatgacccactggacctgggctatgaggttcagatctgcaggtataaagat
taccgggaacccccatggtcagaacacaagtatgacatctccaaagacttctgggctgtc
ctggccgcccgactggcatttgtcattgtcttccagaacctggtgatgttcatgagtgac
tttgtggactgggtgatccctgatatccccaaagacatcagccagcagatccacaaagag
aaggttctcatggtggagctgtttatgcgtgaggagcagggcaagcagcagctactggac
acatggatggagaaggagaagccaagggatgtgccttgtaacaaccacagccccacaacc
cacccagaggcaggcgacggcagcccagtccccagctacgagtaccatggggacgcgctg
tag

DBGET integrated database retrieval system