KEGG   Mus musculus (mouse): 102141
Entry
102141            CDS       T01002                                 

Gene name
Snx25, AI661919, Gm1699, Gm173, Sbbi31
Definition
(RefSeq) sorting nexin 25
  KO
K17887  sorting nexin-25
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    102141 (Snx25)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    102141 (Snx25)
SSDB
Motif
Pfam: Nexin_C PXA RGS PX End3 Isy1 DEK_C
Other DBs
NCBI-GeneID: 102141
NCBI-ProteinID: NP_997096
MGI: 2142610
Ensembl: ENSMUSG00000038291
Vega: OTTMUSG00000024631
UniProt: Q3ZT31
Position
8; 8 B1.1
AA seq 840 aa
MDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWEIVKQIRQRLSHVDVVKVVC
NDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFLQTCSQVLVLCLLPSKD
IQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQLEYREQMSEHHKRAYTYAPSY
EDFIKLINSNSDVDFLKQLRYQIVVEIIQATTISSFPQLKRHKGKESAAMKTDLLRARNM
KRYINQLTVAKKQCEKRIRILGGPAYDQQEDGASDEGEGPQSQKILQFEDIMTNPFYRER
FGTYMERIDKRALVGFWESAEHLKNANKSEIPQLVSEMYQNFFVESKEISVEKSLYKEIQ
QCLVGNRGIEVFSKIQADVSEVLRERYYPSFLVSDLYEKLMREEEEEEPDAQLASEKDEL
GSGGEAGEEAVEGTSGVSDPASFAVIKLRELNEKLEYKRQALSSIQNAPKPDKKIISKLK
DEILLIEKECTALQLHMARTDWWCENLGLWRASITSAEVTEENGEQMPCYFVRVNLQEVG
GVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGKSRNQLNA
FLQNLLSDERLFQSEALYAFLSPSPDYLKVIDVQGKKTSFSLSSFLEKLPRDFFSHQEEE
IEEDSDLSDYGDDVDGKKDSLAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINK
QIRDTVSWISSEQMLVYYISAFRDAFWPNGKLAPPTRIRSVAQSQETKQRAQQKLLENIP
DTLQSLVGQQNARHGIIKIFKALQETKANKHLLYVLMELLLTELCPELRAHLDQFKAGQV
NT seq 2523 nt   +upstreamnt  +downstreamnt
atggatcgtgttctgagagatgtgttcgactacagttacagagactatattctctcctgg
tacgggaacctcagcagagatgacggacagctctaccatctgctcttagatgacttctgg
gaaattgtcaagcagattcgccagaggctgagtcacgtggatgtggttaaagttgtctgt
aatgatattgtaaaggctttgctcactcacttctgtgacctgaaggctgctactgccaga
catgaagaacagccaaggccttttgtgttgcatgcatgcttgaaggattcacatgatgaa
gtaagattccttcaaacatgttctcaggttctggtgttatgccttctcccttctaaggat
atccagtctctcagcttacgtacaatgctcgcagaaattcttacgacaaaagtcttgaag
ccagtagtggaattgctgagtaaccctgactacattaaccaaatgctgctcaggcagttg
gagtacagagagcagatgagtgagcatcacaagcgagcctacacgtacgcgccttcctac
gaggactttatcaagctcatcaacagcaactctgatgtggacttcctgaagcagctcagg
tatcaaattgtagtggagataatccaagcaactacaatcagcagctttccccagctgaag
agacacaagggtaaggaatcagctgccatgaaaactgatctcttgagggccaggaacatg
aaaaggtacattaaccagctgactgtggcaaagaagcagtgtgagaagagaatccgaatc
ctgggaggtcctgcctatgaccagcaagaggatggagcctcggatgaaggggaagggcct
cagagccaaaagattcttcagtttgaagatattatgaccaatcctttctaccgagagcgc
tttggaacatacatggaacggatagacaagcgggctctagttggcttttgggagtctgcc
gaacacctgaagaatgctaacaagagtgaaattccacaattagttagtgaaatgtatcag
aatttcttcgtggaaagcaaggaaatctccgtggaaaagtcactttacaaagaaatccag
cagtgtcttgtgggaaacagaggcatcgaggtgttcagcaaaatccaagccgatgtgtcc
gaggtgctgagggagcggtattacccctccttcctcgtcagcgacctgtatgagaagctc
atgcgtgaggaagaagaggaggagcctgacgctcagctggcctctgagaaggatgagctg
ggttcaggaggtgaggctggtgaggaggctgtagaaggcaccagtggggtcagtgatcca
gccagctttgctgtaatcaaactccgagagctaaatgagaaacttgaatacaaaaggcaa
gctctaagttctattcagaatgcaccaaaacctgataagaagattatttccaagttgaag
gatgaaatacttctgatagagaaagaatgcacggctcttcagctgcacatggcgagaaca
gattggtggtgtgagaacctgggcctgtggagagcatccatcaccagcgcagaggtgaca
gaagagaatggcgagcaaatgccttgttactttgtcagggtaaatctacaagaagttgga
ggagttgaaactaagaactggaccgtcccaagaaggctcagtgagtttcagaatttacat
cggaaacttagtgagtgtgtcccttctttaaaaaaagtccagttgccttctctcagtaag
ctgcctttcaaatctatagatcacaagttcctgggaaagtcaagaaatcagttaaatgca
tttctacagaacctgctttcagatgaaagactgttccagagcgaagcactttatgccttt
ttgagcccttctcctgactacctcaaggtcattgatgtacaggggaaaaagacctccttc
tcattgtcttcatttctggaaaaacttcctcgtgacttcttctcccatcaggaggaggag
atagaagaggacagcgacctgtccgattacggggatgatgtggacgggaagaaggattcc
ttggctgaaccgtgtttcatgctgatcggggagattttcgaacttcgaggaatgtttaaa
tgggtgcgaagaacattaatcgctcttgttcaggtcacgtttggaagaaccatcaacaag
caaatccgcgacacggtgagctggatctccagcgagcagatgctggtctactacatcagt
gctttccgggatgccttttggccaaacgggaaactggcacctccaacaagaatccgaagc
gtggcacagagtcaggagacgaagcagagagcacagcagaagctgctcgagaacattcca
gatacacttcagagccttgttggacagcaaaatgcccgccatggtataataaaaatattc
aaggcgctgcaagagacaaaggccaacaaacacctgctctatgtgctgatggagctgctg
ctgacagagctctgccctgagctgagggctcacctggatcagttcaaagctggccaagtc
tga

DBGET integrated database retrieval system