KEGG   Mus musculus (mouse): 102193
Entry
102193            CDS       T01002                                 

Gene name
Zdhhc7, AL024087, Gramp2
Definition
(RefSeq) zinc finger, DHHC domain containing 7
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    102193 (Zdhhc7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102193 (Zdhhc7)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    102193 (Zdhhc7)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 102193
NCBI-ProteinID: NP_598728
MGI: 2142662
Ensembl: ENSMUSG00000031823
Vega: OTTMUSG00000027531
UniProt: Q91WU6
Position
8; 8 E1
AA seq 308 aa
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSETDMADRVWFIRDGCGMVCAVMTWLLVVY
ADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES
LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM
YIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGT
QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQMRTR
KGGPEFSV
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcagccgtcgggacacaggctccgggacatcgagcaccatcctctcctgactgacaat
gacaattacgactcagcatcctcttcgtcctccgagactgacatggcagacagggtgtgg
ttcatccgagatggctgtggcatggtctgtgctgtcatgacgtggcttctcgtcgtctat
gcagacttcgtggtgacctttgtcatgctgctgccttccaaagacttctggtactccgtg
gtgaacggagtcctcttcaactgcttggcggtgctcgcgctgtcctcccacctgagaacc
atgctcactgacccgggtgctgtccccaaaggcaacgccacgaaggagtacatggagagc
ttgcagctgaagccaggcgaggtgatctacaagtgccccaagtgttgctgcatcaagccg
gaacgtgcccaccactgcagtatttgcaagagatgcattcgaaagatggaccatcactgc
ccgtgggtgaacaactgcgtcggggagaagaatcagaggttcttcgtgcttttcaccatg
tacatagctctgtcttcggttcatgctctgattctctgtgggcttcagttcatctcctgc
gtccgagggcagtggacagagtgcagcgacttctctcctcccataactgtaatcctgttg
gtcttcctgtgccttgagggcctcctgttcttcaccttcaccgcagtcatgttcggcacc
cagatccactcgatatgcaatgatgaaacagagatcgagaggctgaagagcgagaagccc
acgtgggagcgcaggctgcggtgggaaggaatgaagtctgtcttcgggggccctccctcc
ctcctctggatgaaccccttcgttggcttccgactcaggcggctgcagatgaggaccagg
aaaggaggccccgagttctctgtctga

DBGET integrated database retrieval system