KEGG   Mus musculus (mouse): 102278Help
Entry
102278            CDS       T01002                                 

Gene name
Cpne7, AW047065
Definition
(RefSeq) copine VII
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Copine C2 vWA-TerF-like VWA
Motif
Other DBs
NCBI-GeneID: 102278
NCBI-ProteinID: NP_733785
MGI: 2142747
Ensembl: ENSMUSG00000034796
Vega: OTTMUSG00000027555
UniProt: Q0VE82
Position
8; 8 E1
AA seq 557 aa AA seqDB search
MSGDSERAVAPGVVPAPCASKVELRLSCRHLLDRDPLTKSDPSVVLLQQAQGQWLQVDRT
EVVKSSLHPVFSKVFTVDYYFEGVQKLRFEVYDTHGPSGLTCQDDDFLGGMECTLGQIVA
QKKMTRPLLLRFGRNAGKSTITVIAEDISGNNGYVELSFQARKLDDKDLFSKSDPFLELY
RVNDDGSEQLVYRTEVVKNNLNPVWEPFKVSLNSLCSCEETRPLKCLVWDYDSRGKHDFI
GDFTTTFAEMQKAFEEEQQAQWDCVNAKYKQKKRNYKNSGVVILADLKLHRVHSFLDYIM
GGCQIHCTVAIDFTASNGDPRNSCSLHHINPYQPNEYLRALVAVGEVCQDYDSDKRFSAL
GFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNVAPIISKVA
RMAAAEESTGEASQYYILLILTDGVVTDMSDTREAIVRASHLPMSVIIVGVGNADFTDMQ
ILDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHKELP
PRSLGAQTGEAAASSAP
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgactcggagcgcgcggtggccccgggggtggtgcctgcaccctgcgcctcg
aaggtggagctgcggctgagctgccggcacctgctggaccgggacccattgaccaagtcc
gaccccagcgtggtgctgctgcagcaggcacagggccagtggctacaggtggacagaaca
gaggtggtgaagagcagcctgcatcctgtgttctccaaggtcttcactgtcgactactac
ttcgagggggtgcagaagctacggtttgaggtgtatgacacccacgggcctagtgggctg
acttgccaggatgatgacttcctagggggcatggagtgtaccctgggtcaaattgtggcc
cagaagaagatgacacggccattgctgttgcgattcggcaggaatgctggcaagtccacc
atcacggtgatagcagaggacatctctgggaacaacggctatgtggagctctccttccag
gcccggaaactggatgacaaggacctcttcagcaagtcggaccccttcctagagctgtat
cgggttaatgacgacgggagtgagcagctcgtgtacaggacagaggtagtgaagaacaat
cttaacccagtgtgggaacccttcaaggtgtccctgaattcactctgcagctgcgaggag
acacggcctctgaagtgcctggtctgggactatgactcccgaggaaagcatgacttcatt
ggcgacttcaccaccacgttcgcagagatgcagaaggcctttgaggaggagcagcaggcc
cagtgggactgtgtgaatgccaagtacaaacagaagaagcgcaattacaagaattccggg
gtggtgatcctggcagacctgaagctccacagggtccactccttcctggattacatcatg
ggtggctgccagatccactgtacggtagccatcgacttcacagcctccaacggtgacccg
aggaacagctgctccctccaccacatcaacccttaccagcccaacgagtacctgagggca
ttggtggcagtgggcgaggtctgccaggattatgacagtgacaagcggttttctgctctg
ggatttggagcccggatccctcccaagtatgaggtgtcccacgactttgccatcaatttc
aaccctgaggacgatgagtgtgaaggaatccagggcgtggtggaggcctaccagaactgc
ctgccgaaggttcagctctacggccccaccaacgtggcacccatcatctctaaggtggcc
cgcatggcagcggctgaggagagcacaggagaggcttctcaatattacatactgctgatc
ctcacggacggtgtggtgacggatatgtcggacactcgagaggccattgtgcgtgcctcc
cacctgcccatgtctgtcatcattgttggggtgggcaacgctgacttcacagatatgcaa
atcttagacggggatgatggagtcctgcgttccccacggggcgagcctgcactccgggac
atcgttcagtttgtgcccttccgtgagctaaagaacgcatcccccgcagcactggccaag
tgtgtgttggccgaggtgccaaagcaggtggttgaatactacagccacaaggagctgcct
cctcgaagccttggcgcccagactggagaggctgctgccagctcagcgccatga

DBGET integrated database retrieval system