KEGG   Mus musculus (house mouse): 102294
Entry
102294            CDS       T01002                                 
Symbol
Cyp4v3, Cyp4v2
Name
(RefSeq) cytochrome P450, family 4, subfamily v, polypeptide 3
  KO
K07427  docosahexaenoic acid omega-hydroxylase [EC:1.14.14.79]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    102294 (Cyp4v3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     102294 (Cyp4v3)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   102294 (Cyp4v3)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102294
NCBI-ProteinID: NP_598730
MGI: 2142763
Ensembl: ENSMUSG00000079057
UniProt: Q9DBW0 B2RSR0
Position
8:complement(45758838..45786200)
AA seq 525 aa
MLWLWLGLSGQKLLLWGAASAVSLAGATILISIFPMLVSYARKWQQMRSIPSVARAYPLV
GHALYMKPNNAEFFQQLIYYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDK
SFLYKFLQPWLGLGLLTSTGSKWRTRRKMLTPTFHFTILENFLDVMNEQANILVNKLEKH
VNQEAFNCFFYITLCALDIICETAMGKNIGAQSNNDSEYVRTVYRMSDMIYRRMKMPWLW
FDLWYLVFKEGRDHKRGLKCLHTFTNNVIAERVKERKAEEDWTGAGRGPIPSKNKRKAFL
DLLLSVTDEEGNRLSQEDIREEVDTFMFEGHDTTAAAINWSLYLLGTNPEVQRKVDQELD
EVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVGGYKVTKGTEAI
IIPYALHRDPRYFPDPEEFRPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
LACILRQFWVESNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgttgtggctgtggttagggctcagtgggcagaaactattgctttggggcgcagcgagc
gcggtctccctggccggcgccactatcctgatcagcatctttccgatgctggtaagctac
gcgcggaaatggcagcagatgcggtcaatcccgtcggtggcccgcgcctaccccttggtg
ggacacgcgctttatatgaagcccaacaacgcagaattttttcagcagctaatttattac
acagaagaatttcgacacctgccgatcattaaactttggattggacccgtgcccctggtg
gcactttataaggcagagaatgtggaggtgattttgaccagttctaagcaaattgataaa
tcgtttttgtacaagttcctacagccatggctgggactaggacttcttacaagtacgggg
agcaaatggcgcaccaggaggaagatgctaacgcccactttccattttaccattctggag
aacttcttggatgtcatgaatgagcaagcaaatatattggttaataagcttgaaaaacac
gtcaaccaagaagcctttaattgttttttttacatcactctttgtgctctggatataatc
tgtgaaacggctatggggaagaacatcggagctcaaagcaataatgattccgagtatgtc
cgtacagtgtataggatgagtgatatgatatatagaagaatgaagatgccctggctttgg
tttgacctttggtaccttgtgtttaaagaaggacgggaccacaaaaggggactcaaatgc
ctacatactttcaccaacaatgtcattgctgaacgagtcaaagaaaggaaggcagaggaa
gactggacgggtgctggcaggggtcctatcccctccaaaaataagcgcaaggctttcctt
gacttgcttttgagtgtgactgatgaggaaggaaacagattaagccaggaagacatccga
gaggaagttgacaccttcatgtttgagggtcacgatacaactgctgctgcaatcaactgg
tccttatacctattgggcacgaatccagaagtccagaggaaagtggatcaggagctggat
gaagtgtttggaagatcccatcgtcctgtcaccttggaagacctgaagaaacttaaatat
ttggattgcgtcattaaggagactctccgagttttcccatctgtccctttatttgcccgg
agtcttagcgaggactgtgaagtgggcggttacaaagtcacaaaaggaacggaagcaatc
atcattccctacgcactacaccgagaccccagatacttcccagatccagaggaattccga
ccagagcggttctttcctgaaaattcccaaggacgccatccctatgcctatgtgccattt
tctgctggacctcgaaactgtattggtcaaaagtttgctgtcatggaggagaagaccatt
cttgcctgtatcctgaggcagttttgggtagaatccaaccagaagagagaagaactcggc
ctggctggagatttgattcttaggccaaataatggcatctggatcaagctgaagaggaga
catgaagatgacccctaa

DBGET integrated database retrieval system