KEGG   Mus musculus (mouse): 102371Help
Entry
102371            CDS       T01002                                 

Gene name
Myzap, AA407270, AV006038, Gcom1, Gm20502, Gm640, Grinl1a7, Myozap
Definition
(RefSeq) myocardial zonula adherens protein
  KO
K22031  myocardial zonula adherens protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    102371 (Myzap)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     102371 (Myzap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OmpH BLOC1_2 Spc7 KASH_CCD
Motif
Other DBs
NCBI-GeneID: 102371
NCBI-ProteinID: NP_001028380
MGI: 2142908
Ensembl: ENSMUSG00000041361
Vega: OTTMUSG00000036492
UniProt: Q3UIJ9
Position
9; 9 D
AA seq 466 aa AA seqDB search
MLRSTSTVTLFSGGGAKSPGTPSRRANVCRLRLTVPPENPVPQQTEKKIERKDQPPELSN
GESTKRLPQGVVYGVVRRSDPNQQKEMVVYGWSTNQLKEEMNYIKDVRATLEKVRKRMYG
DYDEMRQKIRQLTQDLSVSHAQQDYLDSHIQAQASALDSFNAMNAALASDSVGLQKTLVD
VTLENSHIKDQIRHLQQTYEASMDKLREKQRQLEAAQMENQLLKMRVESSQEANAEVMRE
MTRKLYSQYEEKLQEAQRKHSAEKEVLLEETNSFLKAIEEANKKMEAAELSLEEKDQKIG
ELDRLIERMEKERHQLQLQLLEHETEMSGEMADSDKNRYQQLEEASASLRERIRHLDDMV
HCQQKKVKQMVEEIESLKKKVQQKQLLILQLLEKISFLEGENNELQSRLDYLTETQPKTE
VETREIGVGCDLLPSPTGRTREITMPSRSYTPYTRVLELSSKKTLT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctccacgtccactgtcaccctgttctcaggtggcggcgccaagtcgcctgga
acgcccagtagaagggcaaatgtctgcagactgcggctgactgtgccccctgagaatcca
gtgccacagcaaacagaaaagaagatcgaaaggaaagatcagcctccagaactaagcaat
ggagaatctaccaagaggctccctcagggtgttgtctatggtgtggtgcgaagatcagat
cccaaccagcagaaggaaatggtcgtgtatggctggtccaccaatcagctgaaagaagag
atgaattacatcaaagacgtgagggccacactggagaaagtgaggaagcggatgtatgga
gactatgatgagatgagacagaagatccgacagctcacccaggacctgtcggtgtcccat
gctcagcaggactatctagacagtcacatccaagcccaggcatcggccctggatagcttc
aatgccatgaatgcggcattggcatcagactctgttggcttacagaaaacccttgtggac
gtgactttggaaaatagccatatcaaggatcaaatccgacatctgcaacagacctatgaa
gcatccatggacaagctgcgggagaagcagaggcagttagaggctgctcagatggaaaac
cagctcctaaagatgagggtggagtcatcgcaagaagccaatgctgaggtgatgcgggag
atgacgagaaagctgtacagccagtatgaggagaaactgcaggaggcacagcgcaagcac
agtgcggagaaggaggtgctcctggaagaaaccaatagctttctgaaggccatcgaagag
gccaataagaagatggaggcagctgagctcagcctggaggagaaagaccagaagatcggg
gaactggacaggctgattgaacgcatggagaaggaacggcatcagctccagctccagctc
cttgagcatgagacagaaatgtcaggggagatggcagattctgacaagaacaggtaccag
cagctggaggaggcgtcggccagcctccgggagcggatcagacacctggatgacatggtg
cactgccagcagaagaaagtcaagcagatggttgaggagattgagtcattaaagaaaaaa
gtgcaacagaagcagctcctgatactgcagcttttagaaaaaatctctttcctggaagga
gagaataatgaactacaaagcaggttggactatttgacagaaacccagcccaagactgaa
gtggaaacaagagaaattggagtggggtgtgatcttcttcccagcccaacaggcaggact
cgtgaaatcacaatgccttccaggagttacaccccgtacacgagagtcctggagttatcc
tcaaagaaaacgctgacttag

DBGET integrated database retrieval system