KEGG   Mus musculus (house mouse): 102570
Entry
102570            CDS       T01002                                 
Symbol
Slc22a13, AI648912, OCTL1, OCTL3, ORCTL3
Name
(RefSeq) solute carrier family 22 (organic cation transporter), member 13
  KO
K08209  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 13
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    102570 (Slc22a13)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   102570 (Slc22a13)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    102570 (Slc22a13)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 102570
NCBI-ProteinID: NP_598741
MGI: 2143107
Ensembl: ENSMUSG00000074028
UniProt: Q6A4L0
Position
9:complement(119020618..119038171)
AA seq 551 aa
MAQFAQVMAEVGDFGRFQVRLTILMGIPNFLAAFFIFGQVFMVLDEAHHCSVSWVKNHTF
NLSAAEQLAISIPNDTAGRPESCLMFRPPPDSASLEDILSHRFNETQACDSGWDYPENRP
QSLKKEFDLVCDRKNLKKTSQSVFMAGLLVGALVFGPVCDWIGRRPSLLMQVLLSGITSM
ATAFVSSFELYLALRFVLATANAGFLLSTNVLISEWVGPSWRTQAVVLAQSNVALGQMVL
AGLAYGVRNWRLLQITGTAPVLLLFFYFWVLPESPRWLLSQGRTEEAKQLVQKAALVNGR
PLSPELLNQLVPEKTGPSGNALDLFRHPHLRKVTLILIAVWFVDSLVYYSLSFQVGDFGL
DIYVTQLIFGAVEMPGRFLSVLMMEKLGRKWSQLCTLTLAGIMYIIIIFIPGDLPTVVTV
LAVVGKFASAAAFTISYVYTAELFPTIIRQTGMGLVSIFSRVGGIITPLVMLLEQYHQAI
PMVIFGSLPIGAGLLCALLPETRGQTLKDTLQDLEQGLPAGSHKTAPQRQDMEALGRTSS
VRVAVVKSSYF
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctcaatttgcacaggtcatggctgaagtgggcgactttggtcgctttcaggtgcgg
ttgaccatcctgatgggcattcccaatttcctggctgcattcttcatatttggccaagtc
ttcatggtccttgatgaggctcaccactgttcagtgtcctgggttaagaaccacactttc
aacctaagtgccgctgagcagctggctataagcatccccaacgacacagcgggcagaccc
gagtcctgcctcatgttccggccacctcctgacagtgccagcctggaagacatcctgagc
caccgcttcaatgagacacaggcctgtgactcaggctgggactatcctgagaaccggcct
cagtccctaaagaaagagtttgacctggtgtgtgatcgaaagaacctgaagaagacctcc
cagtcggtgttcatggctggtctccttgttggggccctggtctttgggcctgtctgtgac
tggattggccgcagaccctccctcctgatgcaggtgcttctgtcaggcatcacaagcatg
gccacagccttcgtgtccagctttgagctctacttggccctacgctttgtcttggctact
gccaatgctggatttttactaagtaccaatgtcctgatttcagagtgggtggggccatct
tggagaacacaagccgtggtcttggcccagagcaacgttgcccttgggcagatggtgtta
gcaggactggcctatggtgtccgaaactggagactccttcagataacaggcaccgcaccc
gtcttactgctcttcttctatttctgggttctgccagaatctccacggtggcttctgtcc
caaggaaggacagaagaggccaaacaactggtccagaaggcagccttggtgaacggccgg
ccactttccccggagctcctgaaccagctggtccctgagaagacaggcccctcggggaac
gccttggaccttttcagacaccctcacctcaggaaggtgactctgattctcatagctgtc
tggtttgtggacagtctggtgtactacagcctcagcttccaagtgggggactttggcctg
gatatctatgtgacacagctgatatttggagcagtggaaatgcctggccgcttcctcagt
gtcctcatgatggagaagctgggtcgcaagtggagccagctgtgtactctgactctggct
ggcatcatgtacatcattatcatcttcatcccaggagatcttcccacggtggtcactgtg
ctggctgtggtggggaagtttgcctcggctgcggccttcaccatctcctatgtgtacact
gctgagctcttccccaccatcatcaggcaaacaggcatggggttggtgagcatcttctcc
agggtcggtggcatcatcacaccccttgtgatgctgctggaacagtaccaccaggcgatt
cccatggtcatctttggcagcctccccattggagcaggcctactgtgcgctctgcttcct
gagacccggggccagaccctgaaggacaccctccaggacctggagcaggggctccctgca
gggtcccacaaaacagcaccccaaagacaagacatggaggctttgggaagaacttccagt
gtgagggtggctgttgtgaagagctcgtacttctga

DBGET integrated database retrieval system