KEGG   Mus musculus (mouse): 102580Help
Entry
102580            CDS       T01002                                 

Gene name
Alg9, 8230402H15Rik, AI747665, B430313H07Rik, Dibd1
Definition
(RefSeq) asparagine-linked glycosylation 9 (alpha 1,2 mannosyltransferase)
  KO
K03846  alpha-1,2-mannosyltransferase [EC:2.4.1.259 2.4.1.261]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102580 (Alg9)
   00513 Various types of N-glycan biosynthesis
    102580 (Alg9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    102580 (Alg9)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.259  dolichyl-P-Man:Man6GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     102580 (Alg9)
    2.4.1.261  dolichyl-P-Man:Man8GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     102580 (Alg9)
Glycosyltransferases [BR:mmu01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   102580 (Alg9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_22
Motif
Other DBs
NCBI-GeneID: 102580
NCBI-ProteinID: NP_598742
MGI: 1924753
Ensembl: ENSMUSG00000032059
Vega: OTTMUSG00000034198
UniProt: Q8VDI9
Position
9; 9 A5.3
AA seq 611 aa AA seqDB search
MASRRARQRLKGGGGGGGGGGDAGPAAEKLEQLGSREAGAEPRPESGNKAGQVWAPEGST
AFKCLLSARLCAALLSNISDCDETFNYWEPTHYLIYGKGFQTWEYSPVYAIRSYAYLLLH
AWPAAFHARILQTNKILVFYFLRCLLAFVSCVCELYFYKAVCKKFGLHVSRMMLAFLVLS
TGMFCSSSAFLPSSFCMYTTLIAMTGWYMDKTPIAVLGVAAGAILGWPFSAALGLPIAFD
LLARKHRWKSFLLWSLVALALFLVPVVVIDSYYYGKLVVAPLNIVLYNVFTSHGPDLYGT
EPWYFYLINGFLNFNVAFALALLVLPLTFLMEYLLQRFHVQNLGHPYWLTLAPMYIWFII
FFIQPHKEERFLFPVYPLICLCGAVALSALQKCYHFVFQRYRLEHYTVTSNWLALGTVFL
FGLLSFSRSVALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFL
LPDNWQLQFIPSEFRGQLPKPFAEGPLATRTVPTHMNDQNREEPSRYIDISKCHYLVDLD
TMRETPREPNYSSHREEWVSLAHRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPR
KAKPSRKKSGG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccgaagggcccggcagcgcctcaagggtggcggcggcggtggcggcggcggt
ggggatgcgggcccggcggcggagaagctggaacagctcggcagccgggaggcaggcgca
gagccgcggccagagtctggaaataaagcagggcaagtctgggcccctgaaggatccact
gctttcaagtgtctgctctcagcgaggttgtgcgcagcccttctgagcaacatctcggac
tgtgatgaaacattcaactactgggaaccaacacactacctcatctacgggaagggattc
cagacatgggaatattcccccgtgtatgccatccgctcatatgcttacctgctgctgcac
gcctggccagctgcatttcatgcacggattctgcagactaacaagattcttgtattctac
tttttgagatgtctcctggcttttgtgagctgtgtttgtgaactttacttttataaggct
gtgtgcaagaagtttgggctgcatgtgagtcgaatgatgctggccttcctggtgctcagc
acgggcatgttctgctcatcatctgcattcctccccagcagcttctgcatgtacaccacg
ctgatcgccatgacgggatggtatatggacaagacacccattgctgtgctgggagtagca
gctggtgccatcttagggtggccgtttagtgcagctcttggtttacccatcgccttcgac
ttgctggccaggaagcacaggtggaagagttttctcctctggtccctggtggccctggct
ctcttcttggtgcccgtggtggtcattgacagctactattacgggaagttggtggttgcc
cctctcaacattgttttgtataacgtctttacgtctcatggacctgatctttatggtaca
gaaccatggtatttctatttaatcaatggatttctgaacttcaatgttgcctttgctttg
gctcttctggttttgccactgactttccttatggagtacctgctgcagaggttccatgtt
cagaatttaggacacccgtattggctgaccttggcgccaatgtatatttggtttataatt
ttcttcatccagcctcataaagaagagcgctttctcttcccagtctatccgctcatatgc
ctctgtggtgctgttgctctttctgcacttcagaaatgctaccactttgtgtttcaacga
taccgcctggagcattacacggtgacgtccaactggctggcgctgggcacagttttcctg
tttgggctcttgtcgttctcccgctctgtggctctgttcagaggataccacgggcccctt
gatttatatccagaattttacagaattgccacagacccaaccatccacactgtcccagaa
ggcaggcccgtgaacgtctgtgtgggaaaagagtggtatcgatttcccagtagcttcctt
ctgcctgacaattggcagcttcagttcattccatcagagttcagaggtcagctaccaaag
cctttcgcagagggaccactggccaccaggactgttcccactcacatgaacgaccagaac
cgagaggagccttccagatacattgacatcagcaaatgccattacttagtggatttggat
accatgagagaaacacctcgggagccaaactactcatcccacagagaagagtgggtcagc
ctggctcacagaccattcctggatgcgtctaggtcttccaagttgcttcgggcattctat
gttcccttcctgtcagatcagtacacggtgtatgtgaactacaccatcctgaagcctcgg
aaagcaaagccgagcaggaagaaaagtggaggttag

DBGET integrated database retrieval system