KEGG   Mus musculus (mouse): 102626
Entry
102626            CDS       T01002                                 

Gene name
Mapkapk3, 3PK, AI874665, MAPKAP-K3, MAPKAP3, MK-3, MK3, MapkKapk3
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 3
  KO
K04444  mitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102626 (Mapkapk3)
   04370 VEGF signaling pathway
    102626 (Mapkapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    102626 (Mapkapk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102626 (Mapkapk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102626 (Mapkapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 102626
NCBI-ProteinID: NP_849238
MGI: 2143163
Ensembl: ENSMUSG00000032577
Vega: OTTMUSG00000030250
UniProt: Q3UMW7
Position
9; 9 F1
AA seq 384 aa
MDGETAGEKGSLVPPPGALGGSALGGAPAPGVRREPKKYAVTDDYQLSKQVLGLGVNGKV
LECYHRRSGQKCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHGKRCLLIVM
ECMEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSRNIAHRDVKPENLLYTSKE
KDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCG
FPPFYSNTGQAISPGMKRRIRLGQYSFPNPEWLDVSEDAKQLIRLLLKTDPTERLTIMQF
MNHPWINQSMVVPQTPLYTARVLQEDKDHWDDVKEEMTSALATMRVDYDQVKIKDLKTSN
NRLLNKRRKKQAGSSSASQGCNNQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatggcgagacagcaggggagaaggggagtcttgtgcccccgccaggtgcgctcggc
gggtccgccttgggtggtgctccggccccaggtgtgcgacgggaacccaagaagtacgcg
gtgactgatgactaccagttgtccaagcaagtgctgggtctgggtgtgaacggcaaggta
ctggagtgctaccatcggcgctctggccagaagtgtgccctgaagctcctgtatgacagc
cccaaggcccggcaggaggtggaccaccactggcaggcgtcaggcggcccccacatcgtg
cgcatcctggacgtgtatgagaatatgcaccacggcaagcgctgtctcctcattgtcatg
gaatgcatggagggtggtgagctgttcagcaggattcaggagcgtggtgaccaggctttc
actgagagagaggctgcagagataatgcgggacattggcactgccatccagttcttgcac
agccggaacattgcccaccgagatgtcaagcctgaaaacctactctatacatccaaggag
aaggatgctgtacttaaactcaccgattttggctttgccaaggaaaccacccaaaatgcc
ctccagacaccctgctacactccctattatgtggctcctgaggtcctgggtccagagaag
tatgacaagtcctgtgatatgtggtccctgggcgtcatcatgtacatccttttgtgtgga
ttcccacccttctactccaacaccggccaggccatctctccaggaatgaaaagaaggatt
cgcttgggccagtatagcttccctaaccctgaatggttagatgtctctgaggatgccaag
cagctaatccgcctgctcctgaagacagatcccacagagaggctaacgatcatgcagttt
atgaaccatccttggatcaatcaatccatggtggtcccacagaccccactctacacagcc
cgagtgctccaggaagacaaagatcactgggatgacgtcaaggaagagatgaccagtgcc
ctggccactatgcgggtagactatgaccaggtgaagatcaaggacctgaagacctctaac
aaccggctcctcaacaagaggaggaaaaagcaggcaggcagctcctcagcctcacaagga
tgcaacaaccagtaa

KEGG   Mus musculus (mouse): 17164
Entry
17164             CDS       T01002                                 

Gene name
Mapkapk2, AA960234, MAPKAP-K2, MK-2, MK2, Rps6, Rps6kc1
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04218  Cellular senescence
mmu04370  VEGF signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17164 (Mapkapk2)
   04370 VEGF signaling pathway
    17164 (Mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    17164 (Mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    17164 (Mapkapk2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    17164 (Mapkapk2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    17164 (Mapkapk2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    17164 (Mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17164 (Mapkapk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17164 (Mapkapk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   17164 (Mapkapk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 17164
NCBI-ProteinID: NP_032577
MGI: 109298
Ensembl: ENSMUSG00000016528
Vega: OTTMUSG00000049116
UniProt: P49138 Q3U2P8
Position
1; 1 E4
AA seq 386 aa
MLSGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAITDDYKVTSQVLGLGI
NGKVLRIFDKRTQQKFALKMLQDCPKARREVELHWRASQCPHIVHIVDVYENLYAGRKCL
LIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLY
TSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY
ILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRM
TITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKK
IEDASNPLLLKRRKKARAVEDAALAH
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctgtcgggctctccgggccagactccgccggcgcctttccccagccctccaccgcca
gccccggcccagccgccgccgccgttcccccagttccacgtcaagtcgggcctgcagatc
cgaaagaacgccatcaccgacgactacaaggtcaccagccaagtgcttggcctgggcatc
aacgggaaggtgctgcggatcttcgacaagagaacccagcaaaaattcgccctaaagatg
ctccaggactgtccgaaggcgcgcagagaggtggagctgcactggagggcctcccagtgc
ccacacattgtgcacatcgtggatgtctatgagaacctgtatgccgggaggaagtgcctg
ctgattgtcatggagtgtctcgatggtggagagctctttagtcgaatccaggaccgagga
gaccaggcattcacagaaagagaggcgtcagagatcatgaagagcatcggcgaggccatc
cagtacctgcactcgatcaacattgctcaccgggatgtcaagcctgagaacctcttatat
acttccaaaaggcccaatgccattttgaaactcactgattttggctttgccaaggaaacc
accagtcacaactctttgaccactccgtgttatacaccatactatgtggctccggaagtc
ctgggcccggagaagtatgacaagtcctgtgacatgtggtccttgggtgtcatcatgtat
attttgctgtgtgggtatccccccttctattccaatcacggccttgccatctctccgggc
atgaagactcgtattcgaatgggccagtatgaatttcctaacccggagtggtcagaagta
tcagaagaagtgaagatgcttatccggaatctgctaaaaacagagcccacccagagaatg
accatcacagaattcatgaaccacccctggatcatgcaatctacgaaggtccctcagact
ccactgcacaccagccgtgtcctgaaggaggacaaggaacgatgggaggatgtcaaggag
gagatgaccagtgccttggccacgatgcgtgttgactatgagcagatcaagataaagaag
atagaagacgcatccaaccctctgcttctcaagaggcggaagaaagctcgtgctgtggag
gatgcggctctcgcccactga

DBGET integrated database retrieval system