KEGG   Mus musculus (mouse): 102632Help
Entry
102632            CDS       T01002                                 

Gene name
Acad11, 5730439E10Rik, AI987948
Definition
(RefSeq) acyl-Coenzyme A dehydrogenase family, member 11
  KO
K11730  acyl-CoA dehydrogenase family member 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    102632 (Acad11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APH Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 EcKinase HpaB_N DUF1679 DUF2380
Motif
Other DBs
NCBI-GeneID: 102632
NCBI-ProteinID: NP_780533
MGI: 2143169
Ensembl: ENSMUSG00000090150
Vega: OTTMUSG00000031729
UniProt: Q80XL6 A0A0R4J0I6
Position
9; 9 F1
AA seq 779 aa AA seqDB search
METDVTSDTVEVLPQHKFDLRSLEAYLNQHLPGFGSDSRAVLTVTQYRSGQSNPTFFLQK
GSQAYVLRKKPPGSLLPKAHKIDREFKIQKALFSIGFPVAKPLLYCRDASVIGTEFYVME
HVQGRIFRDFSIPGVSSAERAAIYVSVAETLAWLHSLDIRSLKLDKYGTGVGYCKRQVST
WTKQYQASAHQSIPAMDQLSTWLMKNLPDSDSEECLVHGDFKLDNIVFHPKECRVIAVLD
WELSTFGHPLTDLAHLSLFYYWPRTLPMINRGSHIPENTGIPLMEELISIYCHRRGIDPN
LPNWNFFMALSFFKLAGISQGVYRRYLMGNNSSEDSFLTANTVQPLAETGLQLSKRTLRT
TPPQADAKSQLFAQSRRGQEVLTRVKQFMKQHVFPAEKEVAEYYAQSGNSAEKWGHPLVI
EKLKEIAKAEGLWNLFLPAVSGLSQVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLHL
YGSEQQKKQWLEPLLRGDITSVFCMTEPNVSSSDATNIECTIQRDGGGYIVNGKKWWSSG
AGNPKCKIAIVLGRTESPSASRHRQHSMILVPMDTPGVELIRPLSVFGYMDNMHGGHWEV
HFNHVRVPASNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERILQIMCDRAVQREAFK
KKLYEHEVVAHWIAKSRIAIEEIRLLTLKAAHSIDTLGSASARKEIAMIKVAAPKAVCKI
ADWAIQVHGGAGVSQDYPLANMYAIIRTLRLADGPDEVHLSAIAKMELQDQARRLTARM
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggagacggatgtcaccagtgacaccgtggaagtgctaccccagcacaagttcgacctc
aggtccctggaggcctacctgaatcagcacttgccgggctttgggtcagattcccgggct
gtgctgactgttactcaatacagatcaggacagtcaaacccaaccttctttctccagaaa
ggatctcaagcctatgttctcaggaagaaaccacccggctctcttcttcccaaagcacat
aagattgacagagaattcaagatccagaaagccttgttttccattggatttcctgttgcc
aagcccctgctatactgcagagatgcttcagttatcggaacggaattttatgtaatggaa
catgtgcagggtcggatctttcgtgatttttccattcctggagttagctcagcagaacgt
gctgctatatatgtgtctgtggcagaaaccctggcatggctacattctctggatatacgc
tcgctgaagctggacaaatacggtactggagtcgggtactgcaaaaggcaggtgtccacc
tggacgaagcagtaccaggcctcagcccatcagagcatccctgccatggaccagctctcc
acgtggctgatgaagaacttgccagatagtgacagtgaggagtgcctggtccacggagac
ttcaagctggacaacatagttttccaccccaaagagtgtcgggttatagcagtgttggac
tgggagctctcgaccttcggccatcccttgacggacttagcccatctttccttgttttac
tattggcccaggacactgcccatgataaaccgaggctctcacattccagagaacacagga
ataccgttgatggaagaactgatttcaatatactgccaccgaaggggaattgatcctaat
ctccctaactggaatttctttatggccctctcattttttaaattggctggaatatcacag
ggagtctatcgtagatacctcatgggaaataactcatctgaggatagcttcttaactgcc
aatactgtgcaacctctggcagaaactggattgcagctgtcaaaaagaactctcaggact
acaccaccacaggctgatgctaaaagccagctgtttgcacagagcaggagaggccaggaa
gttctcactagagtgaagcagttcatgaagcagcatgtctttcctgctgagaaggaagta
gctgaatactatgctcaaagtggaaactcagcggaaaagtggggacaccccttagtgatc
gaaaaactaaaggaaatagccaaagcagagggcctgtggaatttgttcttgccagctgtg
agcggtctcagccaggtggactatgccttgattgctgaagagacaggaaaatgctttttt
gctccagatgtttttaactgccaagcaccagacacaggcaacatggaggtactgcacctg
tatggcagcgagcagcagaagaagcagtggctggagcctctcctgcgtggcgatatcacc
tccgtcttctgtatgacagagcccaacgtctcatcaagcgatgccacgaacatcgaatgc
accatccagagagatggaggtggctatatagttaacggcaagaagtggtggagcagcgga
gctgggaatcccaagtgcaaaatcgccattgttttgggaagaacggagtctccctctgca
tccagacacagacagcacagcatgatcctcgtgccgatggacacacctggagtggagtta
ataaggcctttgtcggtgttcggctacatggataatatgcatggcgggcactgggaggtc
catttcaatcacgtgcgcgttcctgccagcaacttaatactaggtgaaggcaggggcttt
gaaatttcccaaggccgccttggacctggaagaatccaccactgtatgagaaccgtgggt
ttggcagaacgcattctgcagatcatgtgtgaccgggccgtgcagagggaggccttcaag
aagaagctctacgaacatgaagtcgtggctcactggattgctaagagccgtatagccatc
gaggagatccgcttgctgaccttgaaagcggctcacagcatagatactctgggcagtgcc
tcagccaggaaggagattgcaatgatcaaagtggctgcccccaaagctgtctgcaaaata
gctgactgggccatccaggtgcacggaggcgcgggagtttcccaggattaccctctggct
aacatgtacgccatcatacgcaccctgcgcttggcagacggccctgacgaagtccacctc
tcagcgatcgccaagatggagcttcaggaccaagccagacggttgacagccaggatgtga

DBGET integrated database retrieval system