KEGG   Mus musculus (mouse): 102638837
Entry
102638837         CDS       T01002                                 

Gene name
Tle7, Gm21964
Definition
(RefSeq) TLE family member 7
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102638837 (Tle7)
   04330 Notch signaling pathway
    102638837 (Tle7)
SSDB
Other DBs
NCBI-GeneID: 102638837
NCBI-ProteinID: NP_001357768
MGI: 5439433
Ensembl: ENSMUSG00000095941
Vega: OTTMUSG00000063001
Position
8 D3; 8
AA seq 430 aa
MADMFLRCGSHPLSAAEIPPTLRPSPASRKPPSTAHCAKCLLWRPPGPPSRDSQPVTEMH
SMMQQQWDPHAQDTSGLQSMWFSEAEPEGGTGSRFQPGDKTGQFSSPSLPNREVWSFLKA
IPPIPDEAVVKQKSPCGSWRVGTLRHGKRVNAIAISSAPCHVYTCGTGYIRVWDENALHA
SDRAPQAQLDFQDPRNRVLTCKLFPDEQSLITGGMARGLTLWDLAPTPQVRAQMASTGSI
CYSLALSSDAHLCLASFKGFVEIWDVQNQILIRKHEVPPYASRCVDITGFKFWTGGEDTT
LYSWDLRSYQKLQQHSLCHEILSITHDPSEEWVLAGLKMSDVVILHAHREEKYKAIVQRY
TQHHNLKFASCGTYFMATLDEVIHCLAAPSLRRLFQAEECYNILCCEVSSDNRYLVTGSK
DSATVYQLLY
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggctgacatgttcttgaggtgtggctcccaccccctatcggccgcggaaatcccaccc
accctccgtccaagcccagcctccaggaagcctccctcaactgcacactgcgccaagtgt
ctcctgtggcggcccccgggtccccccagcagagactcgcaaccagtcacggagatgcac
agtatgatgcagcagcagtgggatcctcacgcccaggacacatctggactccagtccatg
tggttttcagaagcagaaccagaaggaggaactggctcaagattccaaccaggagacaag
actggccagttctcttctccatccttgcccaacagagaagtctggtcattcctcaaagcc
attcctcccattccggatgaggcagtggtcaagcagaagtccccatgtggttcctggcgg
gttggaactctccgtcacgggaagcgagtcaacgccattgccatcagcagtgctccctgc
cacgtgtacacgtgtggcactggctatatcagggtgtgggatgaaaatgcgctgcatgcc
tcagacagggcacctcaggcccagctggactttcaggaccctcggaatcgtgtcctcacg
tgcaagctgttccctgatgagcagagtctcatcacagggggaatggccaggggtctgact
ctctgggacctggcacccaccccccaagtcagggcacagatggcttccacgggctccata
tgctactcattggccctttcctctgatgctcacctctgcttggcttctttcaaaggattt
gtggagatttgggatgtgcagaaccaaatcttgatcaggaaacacgaagtccctccctat
gcgtcccgatgtgtggacatcacaggctttaagttctggacaggtggtgaagacaccacc
ctatattcctgggacctgaggagctaccagaagctgcagcaacacagcttatgccatgag
atcctgagcatcacccacgaccccagtgaggaatgggtactagctggcttgaagatgagc
gatgttgtcatcctgcatgctcaccgggaggagaagtataaagctattgtccaaagatac
acacaacatcacaacctcaagttcgcctcttgcgggacctattttatggccactctggat
gaggtgatccactgcctagctgcaccctctctaagaaggttgttccaggcagaggaatgc
tataacattctgtgctgtgaagtgtcctctgataatcggtatctggtcacgggttccaag
gatagtgccacagtgtatcagctcttatactga

KEGG   Mus musculus (mouse): 114606
Entry
114606            CDS       T01002                                 

Gene name
Tle6, 1810057E06Rik, Grg, Grg6
Definition
(RefSeq) transducin-like enhancer of split 6
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114606 (Tle6)
   04330 Notch signaling pathway
    114606 (Tle6)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Other DBs
NCBI-GeneID: 114606
NCBI-ProteinID: NP_444484
MGI: 2149593
Ensembl: ENSMUSG00000034758
Vega: OTTMUSG00000027830
UniProt: Q9WVB3
Position
10; 10 C1
AA seq 581 aa
MTSHRQSSDTFGGILPSTLSSRYLSIVNQLPEEFSSVVSEMMVHLENIFSLAENFFQAIE
RFSRTPDLLERNKMSIGVGAEGDSWPCHVSHEAPMGSAQTTENSAKEEDKQVPESAALQH
PKFKSTPGPQLPTRRRFLSESDELQDPQPVWDAEPQFCQGFLIQGLWELFMDSRQKNQQE
HGGEDSSQESKDSGLCDFKPEPQPRHRNSLSDSADPFLIKSPSALLDYYQEDVSRPQPET
QESSGRADKFLKPLSWGSEVLESSCNQPSTALWQLERFTVPQALQKVRVLKHQELLLVVA
VSSFTRHVFTCSQSGIKVWNLVNQVAEDRDPESHLKCSVQDNKVYLRTCLLSSNSRTLFA
GGYNLPGVIVWDLAAPSLYEKCQLPCEGLSCQALANTKENMALAGFTDGTVRIWDLRTQE
IVRNLKGPTNSARNLVVKDDNIWTGGLDACLRCWDLRMAKVSLEHLFQSQIMSLAHSPTE
DWLLLGLANGQHCLFNSRKRDQVLTVDTKDNTILGLKFSPNGKWWASVGMGNFITVHSMP
TGAKLFQVPEVGPVRCFDMTENGRLIITGSRDCASVYHIKY
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgacttcccacagacagagcagtgacacctttggtggaattttgccttccaccttatcc
agtcggtatttgtccatcgtgaaccagcttccggaggagttcagcagcgtcgtctctgaa
atgatggttcacctagagaacatcttcagcctggcagaaaacttcttccaggcgatagag
cgcttcagtagaaccccagacctcctggagaggaacaagatgagtattggtgttggggct
gaaggggacagttggccatgtcatgtgtctcatgaggccccaatgggctctgcccagacc
acagagaactcagctaaggaagaagacaaacaggtcccagagtctgcagccctccagcac
cccaagttcaaaagcaccccggggcctcagctgcccaccagacgtcggttcctctcagag
agtgatgagctccaggacccacagccggtctgggacgcggagccccagttctgtcaaggc
ttcctgatccagggactctgggaacttttcatggacagccgccaaaagaaccaacaggaa
cacgggggtgaggattcctcacaggaaagcaaagattcaggcctgtgtgactttaaacca
gaacctcagcccaggcacagaaacagcctgagtgactctgccgaccccttcctgatcaag
tctccctcagctcttctagattattaccaagaagacgtcagtcggccccaacctgagacg
caggaatcttctggaagagctgataaatttctgaagcccttgtcctggggctctgaagtc
ttagagagcagctgtaatcagcctagcacagcactctggcaattagagaggttcactgtc
ccccaagcactgcagaaggtgcgtgtgctgaagcaccaggaactgctattggtggtagct
gtgagctccttcacgcggcacgtcttcacctgcagccagagcggcatcaaggtgtggaac
ctcgtgaaccaggtggccgaggacagagacccagaaagccacttgaaatgcagcgtccag
gacaacaaggtgtacctgcgcacctgcctgctgtcctccaacagcaggaccctgttcgcg
ggtggatacaacttacctggcgtgatcgtgtgggacctggcagccccatccctgtatgag
aagtgccagctgccctgcgagggcctgtcctgccaggcactggccaacacaaaggaaaac
atggcccttgccggcttcacagatggcacggtcaggatatgggacctacggactcaggaa
atagtcaggaacctcaaaggccctaccaattcggccaggaaccttgtggtcaaagatgac
aacatctggacagggggtctggacgcctgcctgcgatgctgggacctgcggatggccaag
gtgtcactggagcatctgttccagtcccagatcatgagcctggctcacagtccgaccgaa
gactggctgctgctgggcctggccaatggccagcactgcctgttcaacagcaggaagagg
gaccaggtgctcactgtggacaccaaggacaacaccatcttaggcctcaagttctcccca
aatggcaagtggtgggcgagcgtcggtatgggcaacttcatcacggtccacagcatgccc
accggagcaaaactgttccaggtccccgaggttggccctgtcagatgcttcgacatgact
gagaacggcaggctcatcatcacaggatccagggactgtgcctcggtgtaccacatcaag
tactga

KEGG   Mus musculus (mouse): 21885
Entry
21885             CDS       T01002                                 

Gene name
Tle1, C230057C06Rik, Estm1, Estm14, Grg, Grg-1, Grg1, Tle, Tle4l
Definition
(RefSeq) transducin-like enhancer of split 1
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21885 (Tle1)
   04330 Notch signaling pathway
    21885 (Tle1)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ
Other DBs
NCBI-GeneID: 21885
NCBI-ProteinID: NP_035729
MGI: 104636
Ensembl: ENSMUSG00000008305
Vega: OTTMUSG00000000333
UniProt: Q62440 Q5SQA2
Position
4; 4 C2
AA seq 770 aa
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSALSGQSHLAIK
DDKKHHDAERHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSSDIKKRKVDDKDNYDSDGD
KSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTASSGSSSSLKSK
EVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPL
AVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVG
FDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgttcccgcagagccggcacccaacgccgcaccaagctgcaggccagccctttaagttc
actatcccggagtctctggaccggattaaagaggaattccagttcctgcaggcgcagtat
cacagtcttaaattggagtgtgagaaactggcaagtgaaaagacagaaatgcagaggcac
tacgtgatgtattatgaaatgtcatatggattaaacattgaaatgcacaaacagactgaa
atcgccaagagattgaacaccatttgtgcccaagtcatcccatttctgtctcaggaacat
caacaacaggtggcccaggctgtggaacgtgccaaacaggtgaccatggcagagttgaat
gccatcatcgggcagcagcagttgcaagctcagcatctctcccatggccatggaccccca
gtacctctcacgcctcacccttcaggacttcagcctcctggcatcccgccccttgggggc
agtgccagccttctcgcgctgtctagtgctctgagtgggcagtctcacttggcaataaaa
gatgacaagaagcaccatgatgcagagcgccacagagacagagagcctggcacgagtaat
tccctcttggtcccagacagcctaagaggcacagataagcgcagaaatggtccagagttt
tccagtgacatcaaaaaaaggaaggtggatgataaggataactatgacagtgatggggac
aagagtgatgacaacttagttgtggatgtgtctaacgaggacccttcttctccacatgca
agccccacacactcaccccgggaaaacggaattgacaaaaaccgtctgctgaagaaagat
gcttcaggtagcccggcatccacagcctcctctggaagttcctcttccctgaaatccaaa
gaagtgagcctgcatgaaaaagccaacactcctgttctgaaatccagcacaccgacgcct
cggagcgacatgccaaccccaggcaccagcgctactccaggcctccgtccaggtcttggc
aagcctccagccatggaaccccttgtcaaccaagcagcagctggcctgaggacgcccctg
gcggtgcctggcccataccctgccccctttggcatggtgccccatgcgggcatgaacgga
gagctgaccagccctggtgctgcctatgcaggtctacacagcatgtctccacagatgagc
gctgcagctgctgcagctgctgctgctgtggtggcctatgggcgctccccaatggttggt
tttgatcctcctcctcacatgagagtaccttctatcccccccaacctggcaggaatacct
ggagggaaaccagcatactccttccacgttactgctgatggccaaatgcagcctgttcct
tttccccctgatgccctcattggacctgggattccccgacatgctcggcagatcaacacc
ctcaaccacggggaggtggtgtgtgcagtgaccatcagcaaccccacaaggcacgtgtac
acaggtggcaagggctgcgttaaggtgtgggacatcagccaccccggcaacaagagcccc
gtctctcagctggattgtctgaatagagataactacatccgttcctgtaaattgctacct
gatggctgtactctcatagtgggaggggaagccagtactctatccatctgggacttggca
gctccaactccccgcataaaggcagagctgacatcctcagcccctgcctgttatgctctg
gccatcagccccgactccaaggtctgcttctcatgctgcagtgacggcaacatcgcagtg
tgggacctgcacaaccagaccctggtgaggcaattccagggccacacagacggagccagc
tgtattgacatttctaatgatggcaccaagctctggacaggcggtttagacaacactgtg
aggtcctgggacctgagagaagggaggcagctgcagcagcatgacttcacttcacagatc
ttctctttgggatattgcccaactggggagtggcttgctgtgggcatggaaagcagcaac
gtggaagttctgcatgtgaacaagcctgacaagtaccagctgcacctccacgagagctgc
gtgctgtccctaaagtttgcttattgtggcaaatggtttgtgagtactggaaaagacaac
ctcctaaatgcctggcggacaccatatggagccagcatcttccagtccaaagaatcttca
tcagtgcttagctgtgacatctctgtggatgataaatacatagtcactggctcaggggac
aaaaaggctaccgtttatgaggtcatctactga

KEGG   Mus musculus (mouse): 21886
Entry
21886             CDS       T01002                                 

Gene name
Tle2, Grg, Grg2, mKIAA4188
Definition
(RefSeq) transducin-like enhancer of split 2
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21886 (Tle2)
   04330 Notch signaling pathway
    21886 (Tle2)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ
Other DBs
NCBI-GeneID: 21886
NCBI-ProteinID: NP_062699
MGI: 104635
Ensembl: ENSMUSG00000034771
Vega: OTTMUSG00000027831
UniProt: Q9WVB2 Q3UN01
Position
10; 10 C1
AA seq 767 aa
MYPQGRHPTPLQSGQPFKFSVLEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHY
VMAAPHQCPQGGTSYPHWPRLSPLQYYEMSYGLNIEMHKQAEIVKRLSAICAQMVPFLTQ
EHQQQVLQAVDRAKQVTVGELNSLLGQQNQLQPLSHAPPVPLTPRPAGLVGAGATGLLAL
SGALAAQAQLVAAVKEDRVGVDAEGSRVDRAASRSSSPSPPESLVEEDHPSSRGGSGKQQ
RAEDKDLSGPYDSEEDKSDYNLVVDEDQPSEPPSPVTTPCGKAPLCIPARRDLTDSPASL
ASSLGSPLPRSKDIALNDLPTGTPASRSCGTSPPQDSSTPGPSSASHLCQLAAQPAAPTD
SIALRSPLTLSSPFTSSFSLGSHSTLNGDLSMPGSYVGLHLSPQVSSSVVYGRSPLQMAF
ESHPHLRGSSVSLPGIPVAKPAYSFHVSADGQMQPVPFPSDALVGTGIPRHARQLHTLAH
GEVVCAVTISSSTQHVYTGGKGCVKVWDVGQPGSKTPVAQLDCLNRDNYIRSCKLLPDGQ
SLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAKVCFSCCSDGNIVVWDL
QNQAMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQLQQHDFSSQIFSL
GHCPNQDWLAVGMESSHVEVLHVRKPEKYQLRLHESCVLSLKFASCGRWFVSTGKDNLLN
AWRTPYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtaccctcagggaaggcacccgaccccgctgcagtctggccagcctttcaagttctca
gtactggaaatctgtgaccggatcaaagaggaattccagtttcttcaagctcagtaccac
agcctcaagctagaatgtgagaagctggccagcgagaagacagaaatgcaaaggcattat
gtgatggctgcaccccatcagtgtccccagggtggcaccagctatccacactggccaaga
ctgtctcctttgcagtactacgagatgtcctacggactcaacattgagatgcataaacag
gctgagattgtgaaacgcctcagtgcgatctgtgcccagatggtcccgttcctcactcag
gagcatcagcagcaggtgctccaggctgtggaccgagccaagcaggtgaccgtgggggaa
ctgaacagcctcctggggcagcagaatcagctccagccgctgtcccacgcaccccccgtg
cctctcaccccgcgcccagccggcctggtgggtgccggggccactgggctgctggcccta
tctggggcactggctgcgcaggcccagctggtggctgccgtaaaggaagaccgtgtgggt
gtggacgccgaggggtccagagtggacagagctgccagcaggagttcttccccgtctccc
cctgagagtctggtggaagaggaccatcccagcagccgaggcggcagtgggaaacagcag
agagctgaagacaaggatctgtcagggccttatgacagtgaggaagacaagagtgactat
aacctggtagtggatgaggaccaaccgtcagagccccccagccctgtgaccaccccttgt
gggaaggcgcccctctgcattcctgcccgcagggacctcacagacagtccagcctccttg
gcctccagtttgggctcaccactccccagaagcaaagacatagccctgaacgatcttccc
acaggcactcctgcctccaggtcatgtggtacctctccaccccaggactcgtccaccccg
gggcccagctcagccagtcacctctgccagctggcggctcagccggcagcacccacagac
agcatcgccctgaggagtcccctgaccttgtccagccctttcacctcatccttcagcctg
ggctcccacagcaccctcaatggggacctctccatgcctggctcctatgtcggcctccac
ctgtccccccaggtcagcagctctgtcgtgtatggacgctcacctctgcagatggcattt
gaatcgcacccccatctccgaggctcgtctgtctccttgcctggcatccctgtggctaag
ccggcttactccttccacgtgtctgcggatggccagatgcagcctgtgcccttcccgtct
gatgctctggtaggcacaggcatccctcgccacgcaaggcagctacacacgctggcccac
ggtgaggtggtgtgtgccgtcaccatcagcagctccacacagcacgtgtacacaggcggc
aaaggatgcgtgaaggtgtgggacgtgggccagccgggtagcaagacccctgtggcacag
ctggattgcctgaaccgagacaactacatccgctcctgcaagctgctgcccgacgggcag
agcctgattgtaggtggcgaggccagtaccctgtccatttgggacctggcagcacccaca
ccacggatcaaagcagagctgacttcgtctgccccggcctgctatgctctggccgtcagt
ccggacgccaaggtctgcttctcctgctgcagcgacggtaacatcgtggtctgggacctg
cagaaccaggccatggtcagacagttccagggccacacggacggggccagctgcatcgac
atatcagactacgggacccggctgtggactgggggcctggacaacactgtgcgctgctgg
gacctgcgcgagggccgccagcttcagcagcatgacttcagttcccagattttctcattg
ggccactgtcccaatcaggactggttggctgtggggatggagagcagccacgtggaggtc
ctgcatgtgcgcaagcctgagaagtaccagctccgcctccatgagagctgcgtgctgtca
ctcaagttcgcttcctgtggacgctggtttgtgagcacaggcaaggacaacctgctcaat
gcctggaggacaccctatggggccagcatttttcagtccaaagaatcatcttctgtactg
agctgcgacatctccaggaataataagtacatcgtgacaggctcaggggacaagaaggcc
actgtgtatgaggtggtgtactga

KEGG   Mus musculus (mouse): 21887
Entry
21887             CDS       T01002                                 

Gene name
Tle3, 2610103N05Rik, ES, ESG, Grg, Grg3, Grg3a, Grg3b, mKIAA1547
Definition
(RefSeq) transducin-like enhancer of split 3
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21887 (Tle3)
   04330 Notch signaling pathway
    21887 (Tle3)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ Ribosomal_S18
Other DBs
NCBI-GeneID: 21887
NCBI-ProteinID: NP_033415
MGI: 104634
Ensembl: ENSMUSG00000032280
Vega: OTTMUSG00000035108
UniProt: Q08122 Q80TC1
Position
9; 9 B
AA seq 772 aa
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHLSHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLAV
KDEKNHHELDHRERESSTNNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARGLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTP
ITLTSSYPAPFAMMSHHEMNGSLTSPSAYAGLHNIPSQMSAAAAAAAAAYGRSPMVSFGA
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQI
NTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKL
LPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTS
QIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGK
DNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtatccgcaaggcagacatccggcaccccatcaacccgggcagccgggatttaaattc
actgtggccgagtcctgtgacaggatcaaagacgaattccagttcctgcaagctcagtat
cacagcctcaaagtggagtatgacaagctggctaacgagaagacggagatgcagcgccat
tatgtgatgtactatgagatgtcctatggcttgaatattgaaatgcacaagcagacagag
attgcgaagagactgaacacaatcctagcccagatcatgccttttttgtcacaggagcat
cagcagcaagtggcgcaggctgtggaacgcgccaagcaggtcaccatgacggagttgaac
gccatcatcgggcagcagcaactccaggcccagcacctctcccatgccacgcatggtccc
ccggtccagctgccaccccacccgtcaggcctccagcctcctgggattcccccagtgaca
ggaagcagctctgggttgctggcacttggtgccctgggaagtcaagctcacttggcggtg
aaggatgagaagaaccaccatgaactggatcacagagagagagagtccagcacgaacaat
tccgtgtcaccctctgaaagcctccgggccagtgagaagcaccggggctctgcagactac
agcatggaagccaagaagcggaaggcggaagagaaagacagcctcagcagatacgatagc
gatggggacaagagtgacgacctggtggtggatgtctctaatgaggacccagcaacaccc
cgggtgagcccagcacactcccctcctgaaaatgggctggacaaagcccgtggtctgaag
aaagatgcccccaccagcccagcctccgtggcttcctccagcagcacaccttcctccaag
accaaagaccttggtcataatgacaaatcttccacacctgggctcaagtccaacacacca
acgccaagaaatgatgccccaactccaggcaccagcaccaccccggggctccggtcaatg
ccgggcaaacctccaggcatggacccgataggtataatggcctcggccctgcgaacaccc
atcaccctcaccagctcctatccagcaccctttgccatgatgagccaccacgagatgaat
ggctccctcaccagcccaagcgcctatgctggcctacacaacatcccatcccagatgagc
gccgccgcagccgctgcagccgccgcctatggccgatcgccaatggtgagctttggagct
gttggttttgaccctcaccccccaatgagggccacaggcctgccttccagtctcgcctcc
attcctggagggaaaccggcatactccttccatgtgagtgctgatgggcagatgcaacct
gtgcccttcccccatgatgcactagcaggccctggcattcccaggcatgcccggcagatc
aatacgctcagccatggagaggtggtatgtgctgtgaccatcagcaaccccacacgacac
gtctacacaggcggcaagggctgtgtgaagatatgggacatcagccagccgggcagcaag
agtcccatctcccagctggactgcctgaacagggacaactacatccgctcgtgcaagctt
ctccccgatgggcgcacgctcattgtgggtggtgaggccagcacgctcaccatctgggac
ctggcctcacccacaccccgcatcaaggctgagctgacgtcctcggctccagcctgttat
gccctggccatcagtcctgatgccaaagtctgtttttcctgctgcagcgacgggaacatt
gcggtttgggatctgcacaaccagaccctggtcaggcagttccagggccacacagatggg
gccagctgtatagacatctctcatgatggcactaagctgtggaccgggggcctggacaac
accgtgcgctcctgggacctacgtgaaggacggcagttacagcaacacgatttcacctcc
cagatcttctccctgggttactgccccactggggagtggctggccgtgggcatggagagc
agcaatgtggaggtcctgcaccacactaagcccgacaaataccagctgcacctgcacgag
agctgcgtgctgtccctcaagttcgcctattgtggcaagtggtttgtgagcactgggaaa
gacaaccttctcaatgcctggaggacgccttatggagccagcatcttccagtcaaaagaa
tcctcatctgtcttgagctgtgacatttcagcggatgacaaatatattgtaacaggctct
ggtgacaagaaggccacagtttacgaggtcatctactga

KEGG   Mus musculus (mouse): 21888
Entry
21888             CDS       T01002                                 

Gene name
Tle4, 5730411M05Rik, AA792082, Bce-1, Bce1, ESTM1, ESTM13, ESTM14, Grg, Grg4, X83332, X83333, grg-4
Definition
(RefSeq) transducin-like enhancer of split 4
  KO
K04497  groucho
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21888 (Tle4)
   04330 Notch signaling pathway
    21888 (Tle4)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ DUF4662
Other DBs
NCBI-GeneID: 21888
NCBI-ProteinID: NP_035730
MGI: 104633
Ensembl: ENSMUSG00000024642
UniProt: Q62441 Q3UY41
Position
19 A; 19 9.11 cM
AA seq 773 aa
MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGSEKHRNSTDYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASVASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgattcgcgacctgagcaagatgtacccgcagacgcgccacccggcaccgcatcagcct
gctcaacccttcaaatttacaatttcagaatcctgtgatcggattaaggaagagtttcag
tttttacaggctcaataccacagtctgaagctggaatgtgagaagctcgccagcgagaag
acagagatgcagcggcattatgtcatgtattatgaaatgtcctatgggttgaacatagaa
atgcacaagcaggcagagattgttaaacgactaaatgctatctgtgcacaggtcattcct
ttcctgtcccaagagcaccagcaacaagtggtgcaggctgtggaacgggccaagcaggtg
accatggcagaactgaacgccatcattgggcaacaactccaagctcagcatttatcacat
ggacatggtctgcctgtgcctctgacaccacacccttcagggcttcagcccccagccatc
ccacctatcggtagcagtgcaggacttctggccctctccagtgcactaggaggtcagtct
cacctcccaattaaggatgagaagaagcaccatgacaatgatcaccaaagagacagagac
tccatcaagagctcttccgtatccccatcagccagtttccggggttctgagaaacatagg
aactctacagactattcctcagagagcaaaaagcagaaaacagaagaaaaagaaattgca
gctcgctatgacagtgatggtgagaagagtgatgacaacttggtagttgatgtgtccaat
gaggatccatcttccccccgaggaagcccagcacattccccaagggagaatggcctggac
aagacacgactcctcaagaaagatgcccccatcagccccgcttctgttgcatcttccagc
agtactccttcctccaaatccaaagagcttagccttaatgaaaagtctactactcctgtt
tcaaagtccaatacccctactccacgaactgatgcacctacccctggcagtaattctact
cctggactgaggcctgtacctggaaagccaccaggtgtggaccccttagcatcaagcctg
aggaccccgatggctgtaccttgtccatatccaaccccctttgggatcgtgccccatgct
gggatgaacggagagctgaccagccccggagccgcctatgctgggctacacaacatctcc
ccccagatgagtgcagctgctgctgcagctgcggcagcagcagcctatggaagatcacct
gtggtgggatttgatccacaccatcacatgcgagtgccagcaatacctccaaatctaaca
ggcattccaggaggaaaaccagcatactcctttcacgtcagtgccgatggccagatgcag
cctgtccctttcccccctgatgccctcattggaccagggatcccccgacacgctcgacag
atcaacaccctcaaccatggggaggtggtgtgtgcagtgaccatcagcaaccccacaagg
cacgtgtacacaggtggcaagggctgtgttaaggtctgggacatcagccaccctggcaac
aagagcccagtctctcagctggactgtctgaacagggataactacatccgttcctgcaga
ttgctccctgatggtcgcaccttaattgttggaggggaagccagcacactgtccatctgg
gacctggcagctccaactccacgcatcaaggcagagctgacatcctcagcccctgcctgc
tatgctctggccatcagccccgactccaaggtctgcttctcatgctgcagcgacggtaac
atcgcagtgtgggatctgcacaaccagactctggtgaggcaattccaggggcacacagat
ggagccagctgtattgacatttctaatgatggcaccaagctctggacaggtggtttggac
aacactgtgaggtcctgggacctgcgtgaagggcggcagctgcagcaacatgacttcacc
tctcagatcttttcattgggctattgcccaactggagagtggcttgcagtggggatggag
aatagcaatgtggaagtattgcatgtcaccaaaccagacaaataccagttgcatcttcat
gagagctgtgtgctgtcactcaagtttgcccactgtggcaaatggtttgtaagcactgga
aaggacaaccttctgaatgcttggaggacgccttatggggccagcatattccagtccaaa
gaatcctcatcggtgcttagctgtgacatctctgtggatgacaagtacattgtcactggc
tctggggacaagaaagctacggtttatgaagttatttattaa

DBGET integrated database retrieval system