KEGG   Mus musculus (mouse): 102680
Entry
102680            CDS       T01002                                 

Symbol
Slc6a20a, A730081N20Rik, AU022428, Xt3s1, Xtrp, Xtrp3s1
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter), member 20A
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    102680 (Slc6a20a)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   102680 (Slc6a20a)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 102680
NCBI-ProteinID: NP_631881
MGI: 2143217
Ensembl: ENSMUSG00000036814
Vega: OTTMUSG00000036109
UniProt: Q8VDB9
Position
9 F4; 9 74.26 cM
AA seq 592 aa
MEKARPQWGHPLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLY
LELAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWGFWYLFHSFQDP
LPWSVCPLNSNHTGYDEECEKASSTQYFWYRKTLNISPSIQENGGVQWEPALCLTLAWLM
VYLCILRGTESTGKVVYFTASMPYCVLIIYLVRGLTLHGATNGLMYMFTPKMEQLANPKA
WINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVSIINSSTSIFASIVTFSIYGF
KATFNYENCLNKVILLLTNSFDLEDGFLTVSNLEEVKNYLASTYPNKYSEVFPHIRNCSL
ESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
SKVISSYLPKEAISGLVCLINCAVGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAV
CYVYGLKRFESDLRAMTGRTLSWYWKVMWAFVSPLLIVGLFIFYLSDYILTGTLQYQAWD
ATQGQLVTKDYPPHALAVIGLLVASSTMCIPLVALGTFIRNRLKRGGSAPVA
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggagaaggcacggcctcagtggggccatccgctgcagttcgtgttcgcctgcatctcc
tacgccgtgggtttgggcaacgtgtggcgcttcccttacctgtgccagatgtacggcgga
gggagtttcctggtcccctacatcatcatgctcattgtggaggggatgccactcctgtac
ctggagctggccgtgggacagcgcatgcggcagggcagcattggtgcctggaggaccatc
agcccctacctcagtggtgtcggtgttgccagtgttgtggtctccttcttcctctccatg
tactacaatgtcatcaatgcctggggcttctggtacctcttccactccttccaggatccc
ctgccgtggtctgtctgcccactgaacagcaaccacacaggctacgatgaggagtgtgag
aaggcttcgtcgacacagtacttctggtacaggaaaacactcaacatctcaccgtccatc
caggagaatggaggagtgcagtgggagccagcgctgtgcctcaccctggcctggctgatg
gtctatctgtgcatcctgagaggcaccgaatctactggcaaggtggtctacttcaccgca
tcgatgccttactgtgttcttattatctacttggtccgtggccttacactccatggagcc
accaatggcctgatgtacatgttcacacctaagatggaacagctagccaaccccaaggcc
tggatcaatgcagccacgcagatcttcttctcactgggcttgggttttggcagcctgatc
gcttttgccagctacaatgaaccctccaacaactgccagaagcatgccattattgtgtcc
atcatcaacagctccacctccatatttgccagcattgtcaccttctccatctatggcttc
aaggccaccttcaactatgaaaactgcttaaacaaggtgattctgctgctgaccaattct
tttgaccttgaagatggctttctgacagtcagcaacctggaggaggtgaagaactacctg
gcatctacttacccaaacaagtacagtgaagtgttcccacacattagaaactgcagcttg
gaatcagagctggacacggctgtccagggcacaggcctggccttcatcgtctacactgag
gccattaaaaacatggaagtttcccagctctggtcagtgctctacttcttcatgctgctg
atgctgggtatcggaagcatgcttggaaacacagcggccatcctcacccctctgactgac
agcaaggtcatctccagctacctgcccaaggaggccatttcaggtttggtatgcctcatc
aactgtgctgttggcatggtgttcaccatggaggctgggaactactggtttgacatattc
aatgactatgcggccaccctgtctctgctgctcattgtgctggtagagaccatagctgtg
tgctatgtgtatgggctgaagagatttgaaagtgaccttcgggccatgactggccgcacc
ctcagctggtactggaaggtcatgtgggcgtttgtgagtccactgctcatcgtcggcctc
tttatcttctacctgagtgactacatcctcacgggaacactgcagtaccaagcctgggat
gctactcaggggcagttggtgaccaaggattaccccccacatgcgctagctgtcatcggt
ttgctggtggcttcatctaccatgtgcatccccctggtggccctggggactttcatcagg
aatcgcctcaagaggggaggctctgccccagtggcctaa

DBGET integrated database retrieval system