KEGG   Mus musculus (mouse): 102693
Entry
102693            CDS       T01002                                 

Gene name
Phldb1, AU041016, D330037A14Rik, L, Ll5a
Definition
(RefSeq) pleckstrin homology like domain, family B, member 1
  KO
K23794  pleckstrin homology-like domain family B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    102693 (Phldb1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   102693 (Phldb1)
SSDB
Motif
Pfam: PH PH_8 PH_3 PH_11 WD40_alt FHA
Other DBs
NCBI-GeneID: 102693
NCBI-ProteinID: NP_705765
MGI: 2143230
Ensembl: ENSMUSG00000048537
Vega: OTTMUSG00000033492
UniProt: Q6PDH0
Position
9; 9 A5.2
AA seq 1371 aa
MDPLNRSQLGPGCKTQAVVQKGPLDLIETGQGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGVRAPGPTYNPGSAESESLVNGNHTAQPATRAP
SACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYLLSPPTSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPSVPPLVPARSSSYHLALQPPQ
SRPSGSRSSDSPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRTTESPRLGGQLPVV
AISLSEYPSSGARSQPASIPGSPKFQSPVPAPRNKIGTLQDRPPSPFREPPGTERVLTSS
PSRQLVGRTFSDGLAATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPARTAP
DPKLSREVAESPRPRRWAAHGTSPEDFSLTLGARGRRTRSPSPTLGESLAPRKGSFSGRL
SPAYSLGSLTGASPRQSPRAQRKLSSGDLRVPIPRERKNSITEISDNEDELLEYHRRQRQ
ERLREQEMERLERQRLETILNLCAEYSRADGGPETGELPSIGEATAALALAGRRPSRGLA
GAIVVSGRCGEESGGASQRLWESMERSDEENLKEECSSTESTQQEHEDAPGAKHQGEVLA
VEEERAQVLGRVEQLKIRVKELEQQLQEAAREAEMERALLQGEREAERASLQKEQRAVDQ
LQEKLVALETGIQKDRDKEADALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKA
ELLRSVSKRKERLAVLDSQAGQIRAQAVQESERLAREKNAALQLLQKEKEKLNVLERRYH
SLTGGRPFPKTTSTLKEMEKLLLPAVDLEQWYQELMSGLGTGLAAASPRSSPPPLPAKAS
RQLQVYRSKMDSDAASPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLAQNGT
SSLPRNLAATLQDIETKRQLALQQKGHQVIEEQRRRLAELKQKAAAEAQCQWDALHGAGP
FSAGPSGFPALMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPD
NMSSASGLDMGKIEEMEKMLKEAHAEKSRLMESREREMELRRQALEEERRRREQVERRLQ
SESARRQQLVEKEVKLREKQFSQARPLTRYLPNRKEDFDLKTHIESSGHGVDTCLHVVLS
SKVCRGYLIKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHL
RSAAKSPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN
NT seq 4116 nt   +upstreamnt  +downstreamnt
atggatcctctcaataggagccagctaggccctggatgcaagacccaggctgtagtgcag
aaagggccattggatctgattgagacgggtcaaggactgaaggtgcagacggacaaacct
catctggtgagcctgggcagcgggagactcagcacagcgatcactctcctgccgctggag
gaagggaggacagtcattggttctgcagccagggacatctcactgcagggtccaggcctg
gctccagaacactgctacatcgagaatctgcggggcactctcaccctgtacccttgtggc
aatgcctgcactattgatgggctccctgttcggcagcccacccggctcactcagggctgc
atgttgtgtctgggtcaatccaccttcctgcgctttaaccatccagccgaagccaagtgg
atgaaaagtatgattccagcaggggtccgggccccagggcccacctacaaccctggctct
gctgaatcggagagcctggtcaatgggaaccacacagcacaacctgcaacccgggcaccg
tcagcctgtgccagccacagttccctggtgagctctattgaaaaggacctgcaggaaatc
atggattcattggtgctagaggagcctggagctgcaggcaagaagcctgctgccacatcc
ccattgtcgccaatggctaacggcgggcgctacctgttgtcccctccaaccagccccggt
gccatgtctgtgggctccagctatgagaacacctctccagccttctctccactttcctca
ccagccagcagcggaagctgtgctagccattcaccaagtgggcaggagccaggaccctct
gtgcccccattggtgcctgcccgctcctctagctaccatttggctctgcaacctccacag
tctcgcccaagtggttcccgctcctctgacagtccccggctgggcagaaaagggggtcat
gagagacctcccagccctggtctccggggtcttctgacggacagtcctgccgctaccgtc
ttggctgaggcccgcagaaccactgagagtccccggctaggtgggcagttacctgtggtg
gctatcagcctgagtgaatacccatcttccggtgcccgcagccaacccgccagtattcct
ggcagccccaagttccagtctccagtgcctgctccccgaaacaagatcggcacactccag
gaccgccctcccagtcctttccgtgagcccccaggcacagagcgggtactaacaagcagc
ccctctcgacaactggtgggcagaacattttcggatgggttagcagcaactcgtaccctc
cagccgcctgagagtccccgcctgggccggaggggcctggacagtatgcgggaactgccc
ccgttgagtccatctctgtctcgaagggctctgtccccactgccagcccggactgcccca
gatcccaagctaagcagggaagtggccgagagtccccggccccggcgctgggcagcccac
gggacttcacctgaggacttctccctgactctaggagcacggggtcgcaggactcggagt
ccctcgcccaccctcggggagtccctggcacctcgcaagggtagcttcagtggcaggctg
agcccagcttacagtctgggctctcttactggggcttcacctcgtcagagcccccgtgct
cagcggaagctctccagtggggacttgcgggtacccattccaagggagaggaaaaacagc
atcacggagatcagcgacaatgaggacgaacttctggagtaccaccgtcggcagcgccaa
gagcggctccgggagcaggagatggagaggctggaacgccagcgcctggagaccatcctg
aacctgtgtgctgagtacagccgagctgacgggggacctgagactggggagctgcccagt
attggagaggccacggcagcgctggccttggcaggcaggaggccctcaagaggcttggca
ggagccatagtagtctccggaaggtgcggcgaggagtctggaggtgcctcccagcgcctg
tgggagagcatggagcgctctgatgaagagaatctcaaagaggaatgcagcagcaccgag
agcacccagcaggagcatgaagacgctcctggcgcgaagcaccaaggcgaggtgctggct
gtggaagaggagcgggctcaggttctggggcgagtagaacagctgaagatccgagtgaag
gagctggaacagcagctgcaggaggcagcccgagaggccgagatggagagagcactgctg
cagggggagcgggaggcagagcgagcctcgctgcagaaggaacaaagggcggtggaccag
ctgcaggagaagttggtggccttggagacaggcatccagaaggacagggacaaggaggca
gacgctctagagactgagacaaagctctttgaggacctggagttccagcagctggagcgt
gagagtcgcgtggaggaggagcgggagctggccggccaagggctgctgcggagcaaggct
gagttgctgcgcagtgtgagcaagaggaaggagcgcctagctgtactggacagtcaggct
gggcagatccgggcccaggcagtacaggagtcagagcgtctggcccgggaaaagaatgct
gccctgcagctactgcaaaaggagaaggagaagctgaatgtccttgagaggagataccat
tcgctcacggggggcaggccttttccgaagaccacctccaccctcaaagagatggagaag
ctgctgctccctgctgtagacttagagcagtggtaccaggagttgatgtccgggctgggg
actggccttgctgcagcctcccctcgctcctctcccccgcctttgcctgccaaagcttcc
cgtcagctgcaggtttaccgctccaagatggatagtgatgcggccagccccctgcccagg
acccgtagcggccctctcccctcctcctcaggctcctcctcctcctcttcacagctcagc
gtggctaccctgggccgtagtccttccccaaagagtgctctgctcgcccagaatggcacc
agtagccttcctcgcaacctggcagccacactgcaggacattgagaccaagcgccagctg
gccctacagcaaaagggacaccaagtgatcgaggagcaacggaggagactggcggagctg
aagcagaaggcggcggcagaggctcagtgccagtgggatgccttgcatggtgcagggccc
ttttcagcaggcccttcaggcttccctgcactcatgcatcattccatcctgcatcacctg
ccagctggccgggagcgtggagaggagggcgagcacgcttacgacaccctgagcctggag
agttcagacagcatggagaccagcatctctacaggcggcaactctgcctgttccccggac
aacatgtccagcgccagtggtctggacatgggcaagatcgaggaaatggagaagatgcta
aaggaagctcacgcagagaagagccggctcatggagtccagggagcgggagatggagctt
cggaggcaggccctggaggaggaacggaggaggcgggagcaagtggagcggcggctgcag
agtgagagcgcccgcaggcagcagctggtggagaaagaagtcaagctccgggaaaagcag
ttctcccaggcacggcctcttacacgttaccttcccaaccggaaggaggactttgatctg
aagacccacatagagtcatcaggccacggggtggacacctgcctacatgtggtgcttagc
agcaaggtgtgccgtggctacctgatcaagatgggtggcaagattaaatcgtggaagaag
cgctggtttgtctttgatcggctgaagcgcaccctttcctattacgtggacaaacatgag
acgaagctgaagggggtcatctatttccaggccatcgaggaagtgtactatgaccacctg
cgcagcgcagccaagagtccgaatccggccctcaccttctgtgtgaagacccatgaccgg
ttgtactacatggtggccccgtctgcagaggccatgcgcatctggatggatgtcatcgtc
acgggggccgagggctacactcaattcatgaactaa

DBGET integrated database retrieval system