KEGG   Mus musculus (mouse): 102902673Help
Entry
102902673         CDS       T01002                                 

Gene name
Gm21992, Rbm14-rbm4
Definition
(RefSeq) predicted gene 21992
  KO
K13187  RNA-binding protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    102902673 (Gm21992)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    102902673 (Gm21992)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_7 zf-CCHC RRM_occluded zf-CCHC_3 zf-CCHC_2 zf-CCHC_5
Motif
Other DBs
NCBI-GeneID: 102902673
NCBI-ProteinID: NP_001277056
MGI: 5439461
Ensembl: ENSMUSG00000096370
Vega: OTTMUSG00000042311
UniProt: F7BGR7
Position
19 A; 19
AA seq 477 aa AA seqDB search
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGAVRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKGCVEMVKL
FIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVN
INVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDA
VEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVA
DLTEQYNEQYGAVRTPYTMSYGDSLYYNNTYGALDAYYKRCRAARSYEAVAAAAASAYSN
YAEQTLSQLPQVQNTAMASHLTSTSLDPYNRHLLPPSGAAAAAAAAAACTAASTSYYGRD
RSPLRRATGPVLTVGEGYGYGHDSELSQASAAARNSLYDMARYEREQYADRARYSAF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttgtgggcaatgtcgatggggcggatacgacaccggaggagttggcagct
ctcttcgcgccctatggcacggtcatgagctgcgccgtcatgaaacagtttgccttcgtg
cacatgcgcgagaacgctggcgcggtgcgcgccatcgaggccctgcatggccacgagctg
cgtccaggtcgcgcgctcgtggtggagatgtcgcgcccgaggcccctgaacacttggaag
attttcgtgggcaatgtatcggctgcatgtacaagtcaggaattgcgcagcctcttcgag
cgccgtggacgcgtcatcgagtgtgacgtggtaaaaggctgtgtggagatggtgaagctg
ttcattggaaatctgccccgggaggccacagagcaggagatccgctcactcttcgagcag
tacgggaaggtgctggaatgtgacatcattaagaattatggctttgtgcacatagaggac
aagacggccgctgaggatgccatacgcaacctgcaccactacaagctgcacggagtgaac
atcaatgtggaagccagcaagaataagagcaaagcttcaaccaagttacacgtgggcaac
atcagccccacttgtaccaaccaagagcttcgggccaagtttgaggagtacggcccagtc
atcgaatgtgacatcgtgaaagattatgcctttgtacacatggagcgggcagaggatgcg
gtggaggccatcaggggcctcgacaacacagagtttcaaggcaaacgaatgcacgtgcag
ttgtccaccagccggcttaggaccgcgcccgggatgggagaccagagcggctgctatcgg
tgcgggaaagaggggcactggtccaaagagtgtccaatagatcgttcgggccgcgtggca
gacttgaccgagcaatataatgagcaatatggagcagtgcgtacgccttacaccatgagt
tatggggattcattgtattacaacaacacgtacggagcgctcgatgcctactacaagcgc
tgccgtgctgcccggtcctatgaggcagtggcagctgcagctgcctctgcgtatagtaac
tatgcagagcagactttgtctcagctgccacaagtccagaacacagccatggccagtcac
ctcacctccacctctctcgatccctacaatagacatctgttgccgccttcaggagctgca
gcagcagcagcagctgctgctgcttgtactgcagcttctacttcatattacgggcgggat
cggagccccctgcgtcgcgctacaggcccagtcctcactgttggagagggctacggttac
gggcatgacagtgagttgtcccaagcttcagcagctgctcggaattccctgtacgacatg
gcccggtatgagcgggagcagtatgcggatcgggcgcggtactcagccttttaa

DBGET integrated database retrieval system