KEGG   Mus musculus (mouse): 103135Help
Entry
103135            CDS       T01002                                 

Gene name
Pan2, 1200014O24Rik, AI047843, AW742773, Usp52, mKIAA0710
Definition
(RefSeq) PAN2 poly(A) specific ribonuclease subunit
  KO
K12571  PAB-dependent poly(A)-specific ribonuclease subunit 2 [EC:3.1.13.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103135 (Pan2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    103135 (Pan2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     103135 (Pan2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     103135 (Pan2)
  mRNA degradation factors
   3'-5' decay
    Pan complex
     103135 (Pan2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH_1 RNase_T UCH WD40_like
Motif
Other DBs
NCBI-GeneID: 103135
NCBI-ProteinID: NP_598753
MGI: 1918984
Ensembl: ENSMUSG00000005682
UniProt: Q8BGF7
Position
10; 10 D3
AA seq 1200 aa AA seqDB search
MNFEGLDPGLAEFSPAMHSTLDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEG
VYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGGDDIR
QIQSLENGILFLTKNNLKYMARGGLIIFDYLLDENEDMHSVLLTDNSTLLVGGLQNHVLE
IDLNTVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRDLRSFKVEHEFDAFSGSLS
DFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRL
AIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDS
PEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDALLSDWPAANSAPAP
RRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDHEFDNFSQVTESPTGREE
EPLHTVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEPV
RCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGSNFLRAFRTIPEASALGLILADSD
EASGKGSLARLIQRWNRFILTQLHQDMQELEVPQAYRGAGGSFCSSGDSIIGQLFSCEME
NCSLCRCGSETVRASSTLLFTLSYPEDKTGKNYDFAQVLKRSICLEQNTQAWCDNCEKYQ
PTIQTRNIRHLPDILVINCEVNSSKEADFWRLQAEVAFKIAVKKYGGEMKSKEFALADRK
ELRSPEGFLCSSIEELKNVWLPFSIRMKMTKNKGLDVCNWADEHELSSLGAPSQWGPARA
EEELGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEPI
DKYEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTFI
PLMLNEMPQVGDLVGLDAEFVTLNEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNEG
IPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKLRFLIDIGVKFVG
HGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDAR
TALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPESQTSPKNAAVFSVLAL
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgagggtctggatcctggactggccgaattttccccagctatgcattctacc
ctggacccagtcctggatgcccacctgaatccaagtttgctacagaatgtggagctagac
ccagagggagtggccttggaggctcttcctgtccaggagtcagtgcacataatggaaggt
gtctactctgagttgcacagcgtggtggctgaagtgggagtgcctgtgtctgtctcccac
tttgatttacatgaggagatgctgtgggtggggagccatgggggccatgccacctccttc
ttcggcccagctctggagcgctactcatcctttcaggtcaatggtggtgacgacattcgg
caaatccagagcctggagaacggtatcctcttcctcaccaagaacaacctcaagtacatg
gcccgtggagggctcattatatttgactatttgctggatgaaaacgaggatatgcacagc
gtcctcctgacagacaacagcactctgctcgttggggggctgcagaaccacgtactggag
attgacctgaacactgtccaggagactcagaagtatgcagtcgagacacccggagtcacc
atcatgagacagacaaatcgtttcttcttctgtggccacacatctggcaaggtttccctg
cgagacctccgtagttttaaagtggagcatgaatttgatgccttctcagggagtctgtca
gattttgatgttcatggcaacctgctggctgcctgcggcttctccagtcgccttaccggc
ctggcctgtgaccgtttcctcaaagtgtacgatctgcgcatgatgcgtgccatcacacct
cttcaagtgcacgtggatccggccttcttacgattcatccccacatacacttcccgcctt
gctatcatctcccagtcaggtcaatgccagttttgtgaacccacaggcctggccaaccca
gccgacattttccatgtgaatcccgtgggacctttgctaatgacgtttgatgtgtcagcc
agcaagcaggccctggcctttggggattctgagggctgcgtgcatctctggactgattcc
cctgagccgtccttcaacccctactcccgagagactgagtttgccctgccctgtcttgtg
gactccttgccgcctctggactggagccaggatctgctgccgctttccctcattcccgtc
ccacttaccactgatgcactgctctctgactggcctgctgccaactctgctcccgctccc
aggcgagcaccacctgtggatgcagaaattcttcgaaccatgaagaaagtgggcttcatt
ggctatgctcccaaccctcgcaccaggctgcgcaaccagattccctatcgactaaaggag
tcagaccatgaatttgacaacttcagccaagtcacggagtcaccgacagggcgagaagag
gagcctctccacacagtttctaagaaataccggaaggtaaccatcaaatattccaagcta
ggcctggaagactttgacttcaaacactacaataagactctgtttgctgggttagagcct
cacatccccaatgcctactgtaactgcatgatccaggtgctctatttcttggagcctgtt
cgctgtctgatccagaaccacctttgccaaaaggagttctgcctagcgtgcgagctcggc
ttcctcttccacatgctagacctctctcgtggcgatccttgtcagggcagtaatttcctc
cgagctttccggaccatccctgaggcctcagctctgggtctcatccttgctgactcagat
gaggcttcaggcaagggcagtctggcccggctcatccagaggtggaaccgcttcatcctc
actcagctacatcaggatatgcaggagctggaagtgccccaggcttatcgaggtgctgga
ggcagtttctgctcatcaggagactccatcattgggcagctgttcagttgtgagatggag
aactgcagtctttgccgctgcggcagcgagactgtgcgggcctcgtccaccctactcttc
acactctcctaccctgaggataaaaccgggaagaactatgactttgctcaggtgctgaag
cgaagtatctgcctggagcagaacacacaggcctggtgtgacaactgtgagaagtaccag
cccacaattcagaccagaaacatccgacatctgccagatattcttgtcattaactgtgaa
gtgaatagctcaaaagaggctgatttctggagactgcaagctgaggttgccttcaaaata
gcggtgaaaaagtacggcggggaaatgaagagcaaagagtttgctttagctgatcggaag
gaactgaggagtccagagggctttctgtgttcctccatcgaggagctgaagaatgtctgg
cttccattttccatccgcatgaagatgaccaagaacaaaggactggatgtttgcaactgg
gctgacgagcatgagcttagcagcctgggtgccccctcacagtggggtccggccagggca
gaggaggagcttggtgtctatgtatatgacctgatggctactgtggtacacatcctggac
tcacgaacaggcggcagcttggtggctcacatcaaagtcggtgagacctaccaccagcgc
aaggagggcgtgactcatcagcagtggtatctcttcaatgacttccttattgaacctatt
gataagtatgaagccgtgcagtttgacatgaattggaaagtacctgctatcctgtattat
gtcaaaaggaatctcaattccagatacaatctgaatatcaagaaccccattgaggccagt
gtgctgctggcagaagcctcgctggcacggaagcaacggaaaacacacacgacctttatt
ccattgatgctgaatgagatgccacaggtcggggacctggtgggcctggatgccgagttt
gtcactcttaatgaggaagaagcagagttacgcagtgatggtaccaagtccaccattaag
ccaagccagatgtcagtagcaaggatcacctgtgttcggggccaagggcctaacgagggc
atccccttcattgatgactacatctccacgcaggagcaggtagtagattacttgactcag
tactcggggataaagccaggagaccttgatgccaaaatctcctcaaagcacctcacaacc
ctcaagtctacctacttaaagcttcgctttctcattgatattggagtcaagtttgtgggt
catggtctgcagaaggacttccgggtcatcaacctcatggtgcccaaggaccaagttctt
gacacagtctacctgttccacatgccccgaaaacgaatgatttccctacgattcctggcc
tggtattttctagacctgaagattcaaggtgagacccatgacagcattgaggatgcccgc
acagcccttcaactctaccggaagtatctggagctgagcaagaacggcaccgagcccgag
tccttccacaaggtgctcaagggtctctatgagaagggccgaaagatggactggaaggtg
cctgagcctgaaagccagacaagtcccaagaatgcagctgtcttctcagtgctggcactg
tga

DBGET integrated database retrieval system