KEGG   Mus musculus (mouse): 103142
Entry
103142            CDS       T01002                                 

Gene name
Rdh9, AI121090, Cra, Crad3
Definition
(RefSeq) retinol dehydrogenase 9
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103142 (Rdh9)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     103142 (Rdh9)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 103142
NCBI-ProteinID: NP_694773
MGI: 2143528
Ensembl: ENSMUSG00000056148
Vega: OTTMUSG00000027659
UniProt: Q8K5C8
Position
10; 10 D3
AA seq 317 aa
MWLFLVALVGLWTLLCFFRERQVVSYLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAAC
LTEKGAEELRNKTSDRLETVILDVTKTESIVTATQWVKERVGNRGLWGLVNNAGISIPSG
PNEWMKKQDFAHVLDVNLLGLIEVTLSMLPLVRKARGRVINVASVLGRVSLCGGAYCISK
YGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSNTQMLWDQTSSEIREIYGE
KYLASYLKRLNELDKRCNKDLSLVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYLPTF
LVDALLYWTSLKPEKAL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtggctctttctagtggcactggtgggcctttggactctcctgtgcttcttcagggag
aggcaggtggtgagctatctccaagacaagtatgtcttcatcacgggctgtgactctggc
tttgggaacctgctggccagacagctggacaggagaggcatgagagtgttggctgcatgt
ctgacggagaagggagccgaggagctgaggaacaagacatctgacaggctggagacagtg
atcctggatgtcaccaagacagagagtattgtgacagccactcagtgggtgaaggagcgt
gttgggaacagaggactctggggcctggtcaacaacgctggcatctccatcccctcgggt
cccaacgagtggatgaagaaacaggactttgcacatgtactggatgtgaacctgttgggc
ttgatcgaggtgactctgagcatgctgcccttagtgaggaaggcaaggggtcgtgtgatc
aacgtcgccagtgtcttgggccgagtatctttgtgtggtggtgcttactgcatctctaag
tatggtgtagaggccttctcagactccctcaggagggagctctcctactttggggtgaag
gtggctattatagagcctggcttcttcctgaccggtgtgaccagtagtgccagattatgc
tcaaatacccagatgctgtgggaccagaccagctcagaaatcagggagatctatggcgag
aagtacctggcatcctatctgaaaaggctaaacgaattggacaagaggtgcaacaaggac
ctgtctttggtgactgactgcatggagcatgctctgactgcctgtcaccctcgtacccga
tactcagctggctgggatgctaagctcttctacctccccttgagctacctgcctaccttt
cttgtggatgcccttctctattggacttccctgaagcctgagaaagccctctga

DBGET integrated database retrieval system