KEGG   Mus musculus (mouse): 103220Help
Entry
103220            CDS       T01002                                 

Gene name
Ttc41, AI449705, AU041509, Gnn
Definition
(RefSeq) tetratricopeptide repeat domain 41
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT TPR_12 Rad17 AAA_16 AAA_22 DUF4062 ATPase_2 NB-ARC AAA AAA_14 DUF815 AAA_29
Motif
Other DBs
NCBI-GeneID: 103220
NCBI-ProteinID: NP_001003910
MGI: 2387653
Ensembl: ENSMUSG00000044937
UniProt: Q692V3 F8VPV8
Position
10 C1; 10 43.07 cM
AA seq 1318 aa AA seqDB search
MSDEASETGQRYNGQPILKRQKPILPYICSTLDFQEERDFLAKSIFPRLNDICSSRGTYF
KAVDLRWSAVKAHKSFTSNQFRQYSCLQSQHLKLSLDYVNRCFPFFIGLLGQTYGDFLPD
YTPFLLSQVKDFESLSKGEQNLYIAAKNGYPWVLKTPNCSLTEFEIIQAVFRKKSQFQFF
YFRTSNSLLRTFNEEEEEEEEKLSSAYLLNEQGKMKVGKLKAKIIGKGLPVRFYRDLEEL
GDMVWKDWSAVVEKLYPFTTIMGNIDYKHSFENLYHEEFVENCKQVFVTSKESNRTFEIL
ERFAIKDLDLDLDTDSTIAGSGLDSILRINSLPTCKSILLLSGERGCGKSTLIANWVSNF
QSKHPGVLMIPYFVGSTCESCDIMSVIHYFVMELQHRANGPRLEMDFLNEDSNVLVFSLL
VEVFIAAISLKPCILVLDGIEELIGIYGISGQKAKDFSWLPRSLPPHCKFILSSVSSSLS
CKSLCARPDVKIVELNSIGDEDTKFNIFRQHLSPADQERFGQSKPILRKKPNLSPLKLAI
IASELQECKIYRNEFQCLREYLEVASVQELWELILKRWVEDYSWTLKPKDTTLDTVIPGP
SGWVVDVLCLLCISHCGLAEDELLQLLDTMGYRDHHKVTAVHWAAFRQATKTWIQEKPNG
LLYFQHQSLRSAVEHKLLGVSTPVRESNPNVAQNSVNHKKAHFHQVLMRFFQRQTIFWRV
YQELPWHMKMSGYWEGLCNFITNPSITDFISKIQNPSLWTRLHLVHYWDVLLEAGNDVSE
AFLLSVAKIEGEQFQKLKKRTTLSVLECSLSEITAADKGRIILFIGSFLKLMGKINEAEK
LFLSAEDLLLQSPSMTEMLLRAQNAIGELYLEIGMTPKGLTYFQKAWSNLLRFTLSDLKI
SQELMKQKVKVMNNLAKSAPGEFLKENHVLEYATEISKYVTGNPRDHATMKYTEGVLMLA
SGNAALAKLKFQECLTIRRWLFGNKNILVGEIMEFLADLLFFLLGENEKSQKKQAIEYYK
QVIKIKEKADTVATCKLVRKHLSISLSDTLCKLAGQLLSGDFCHHATMEAVSYLYRSLDL
RAAHLGPTHASIEGILHLLREIQRSRGRRSWPQSMNHLFPNGSRNGFSLWENVPKLNFHS
AQSSDTVNTAMCMNIRRFQRVKSTQPSLVSDKPKYVPGKGKKTLAPILCKSAEEKFQRQA
SDSQIWNSPRRQPARKKAACPLKTVSLIDKNGLVRLSRQSVSSAELDSRKGLITSICRQP
LQLPHNVDNPWKSISELVSEKWLFHTPQYCFTPQKPGFPRRSQIESKLLKTSDDPNKE
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaggcaagtgagaccggacaaagatacaacggtcaacccattttaaagcgc
cagaaacccatcctaccttacatatgttccactctagattttcaagaagagagagacttt
ttggccaaaagcatcttccctcggcttaatgacatctgcagctcccggggcacctacttc
aaagctgtggacttgagatggtcagctgtgaaggcccataagtccttcaccagcaaccag
ttccgacagtactcctgtctccagtctcaacacctgaaactctccctggactacgtgaac
agatgcttcccgtttttcatcggcctgctggggcagacctacggagatttcctccccgac
tacacacctttcctgttatcccaagtgaaggacttcgaaagtttatccaagggagaacag
aatctatacattgctgccaaaaatggttacccttgggttctcaagactcccaactgcagc
ctgacagagttcgagatcatccaagcagtattccggaagaaatctcaatttcaatttttc
tacttccggacatcaaattcgctgctgcgaacttttaatgaggaagaggaggaggaagag
gagaagctgtcctcagcatatctgttgaacgaacaggggaagatgaaggttggaaagctc
aaggctaagatcattggcaaagggcttcctgtcagattctacagagacctggaggaactg
ggggatatggtttggaaggactggtcggctgttgtggaaaagctctatccattcactacg
atcatgggaaatatagactacaaacacagtttcgagaatttgtatcatgaagagtttgtg
gagaactgcaagcaagtttttgttacttccaaggagtcaaacagaacctttgaaatattg
gaaagatttgctataaaagatcttgatcttgatcttgatactgacagtactatagcaggt
tcggggttagactccattctcagaatcaattcccttccaacttgtaagtccattttgctc
ttgtctggggaacgcggctgtgggaagtccacactgattgccaactgggtcagtaatttc
caaagcaaacaccccggagtgctgatgatcccatactttgtgggcagtacgtgtgagagc
tgtgacatcatgtctgtgatccactacttcgtcatggagcttcagcacagagccaacggt
ccccggcttgaaatggatttccttaacgaggactcaaatgtcttggtcttttcacttctc
gtagaagtgttcatagccgccataagcttaaagccatgcatcctggtactagacgggatc
gaagagctgatcggtatctatgggatttcaggtcagaaggcgaaagatttctcctggctg
ccgcgctccctgcctcctcactgtaaattcattctgagcagcgtctcctccagtctgtcc
tgcaagtcgctgtgtgcccgccctgacgtgaagatcgtggaactcaacagcatcggggac
gaagacaccaagttcaacatcttcagacagcacctctcccctgccgaccaagaacgcttc
gggcagagcaagcccattttgaggaagaaaccaaacctgagccctctgaagctcgcaatc
atcgccagcgagctgcaggagtgcaaaatctaccgcaatgagttccagtgtctccgggag
tacttggaggttgcctctgtgcaggagctctgggagttgattctgaagcgctgggttgaa
gattatagttggactttgaagcctaaagacacaactctagacaccgtgattccagggcca
agtggctgggtagtggatgtgctgtgcttgctctgcatctctcactgcgggctggctgag
gatgaactgctccagcttttggacacgatgggctacagggaccaccacaaagtgacggcg
gtgcactgggcagccttccgccaagccaccaaaacctggatccaggagaagcccaatggt
ctcctctacttccagcaccagtccctaaggagtgccgtggagcacaagctgctgggtgta
agcactccggtgagagagagcaatcccaatgtggcccagaacagcgtgaatcacaagaag
gcacatttccaccaggtcttgatgaggttcttccagcggcaaaccatcttctggagggtg
tatcaggagctgccctggcacatgaagatgagcgggtattgggaaggtctatgtaacttc
atcacgaaccccagcatcacagatttcatatcgaaaatccaaaacccaagcttgtggacc
aggctgcaccttgtccactactgggatgtgctgctggaagccggcaatgacgtgtctgag
gcttttctgctctctgttgccaagatagaaggggaacaattccagaaactcaagaagcga
accacactctcagtgctggaatgcagcctgtccgagattactgctgctgataaaggcaga
attatcctctttattggaagtttcctgaagctaatgggcaagatcaatgaagctgaaaag
ctgttcttgagcgctgaggacttgttactacagagcccatccatgacagaaatgctgctc
agagctcagaatgccattggggaattatatcttgagattgggatgactccgaaaggactc
acatattttcagaaagcttggtcaaatctgctgcggtttacactcagcgacctaaagatc
agccaggaattgatgaagcagaaagttaaagtgatgaataacctggcaaaatcggcgcct
ggggaattcttaaaagaaaaccacgttctggaatatgctaccgaaatctccaagtacgtg
actggtaatccccgtgatcatgctaccatgaaatatactgaaggtgttctcatgttggct
tccggaaacgcagccctggcaaaactcaagtttcaagagtgtttaactatcagaagatgg
ctatttggcaataaaaacatactagttggagaaattatggaattcttagcagatttacta
ttttttctactaggagaaaatgaaaaatctcaaaagaagcaagcaattgaatattataaa
caagtcataaaaatcaaggagaaggcagatacggtggccacctgcaagcttgtgaggaag
catctgagtataagcctcagcgacaccttgtgtaaactagcaggccagctgttgtcaggt
gacttctgccatcatgccacaatggaggcagtcagctatttgtataggtcacttgattta
agggcagctcacctggggcctacccacgcttccattgagggaatactacaccttttaagg
gaaatccagaggtcccggggcaggaggtcttggcctcaaagcatgaaccatctattccct
aacggttctaggaatggcttttcattatgggagaatgtgcctaaattaaacttccacagc
gctcagagttctgacacggtaaacactgcaatgtgtatgaatatacgtaggtttcagaga
gttaaaagcacacagccttctctggtttcagataaaccaaaatatgttcccggcaaagga
aagaagaccttggctccaattctgtgcaagtctgctgaggaaaagttccaacgtcaggct
tcagactcacaaatatggaatagtccaagaagacaacctgccaggaaaaaggcagcctgt
ccccttaagacggtctcgctcattgacaagaacggcttggtgagactctcaaggcagagt
gtttcttctgctgagctggacagcagaaagggcctgatcacttccatctgccggcaaccc
ctgcagctacctcataatgtggacaatccctggaagtccatatcggaactcgtgtcagaa
aagtggctcttccacactcctcagtactgcttcactcctcagaagccaggcttcccaaga
agatctcagattgaatcaaaattgctgaagacctcagatgaccccaataaggaataa

DBGET integrated database retrieval system