KEGG   Mus musculus (house mouse): 103284
Entry
103284            CDS       T01002                                 
Symbol
Zc3h10, AI790326
Name
(RefSeq) zinc finger CCCH type containing 10
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus zf-CCCH_3 bZIP_1 TSC22 MbeD_MobD ZapB DUF5320
Other DBs
NCBI-GeneID: 103284
NCBI-ProteinID: NP_598764
MGI: 2143670
Ensembl: ENSMUSG00000039810
UniProt: Q8R205
Position
10:complement(128379429..128383877)
AA seq 435 aa
MPDRDSYANGTGSSGGGPGGGGSEEASGAGTGSGGATSDAICRDFLRNVCKRGKRCRYRH
PDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVA
AGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGGSTG
SAPPGRRHDLYDIYDLPERGFEDHEPGPKRRRGGCCPPDGPHFESYECNLAPLRGVECRL
LEEENALLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTV
GTVATFNHGIAQTHTTLSSQALQPRPVSQQELVAPTGAPAAPPTNAAPPAAPPPPPPHLN
PEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVT
YPIASQSMRITAMPH
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcctgaccgggacagctatgccaacggcactggcagcagcggtggaggccctggaggt
ggtggcagtgaggaggccagtggggcagggacaggcagcgggggagccacctcagatgcc
atctgtagagacttcctgaggaacgtctgcaaacgaggcaagcgatgtcgataccgccac
ccagacatgagtgaggtatccaatttgggggtaagcaaaaatgaatttatcttctgccat
gacttccaaaacaaggagtgtagccgccccaactgtcgtttcatccacggctccaaggag
gatgaggatggctataagaagacaggagagctgcctccccggctgaggcagaaagtggcc
gctgggctgggtctctcacccgccgacctacccaatggtaaggaggaggtccccatctgc
cgcgacttcctcaaaggtgactgtcagagaggagccaagtgcaagtttcgtcacctgcaa
agggattttgagtttgatgctcgcggtggaggaggcactggaggtggaggctccacaggc
tctgctcccccaggacgccgtcatgatctctatgacatctacgaccttccggaaaggggc
tttgaggaccacgaaccaggccctaagcgccggagaggtggctgctgccctcctgacggc
ccccatttcgagtcctacgaatgtaacttggctccgctccgtggggttgagtgcagactg
ctggaggaggagaacgccctgctcaggaaacgcgtggaggagctgaagaagcaggtcagc
aacctgctggccaccaatgaggtacttctggagcagaatgcccagttccggaatcaggcc
aaggtgatgactctgagctccactgcccccgcgactgagcagaccctggcccccactgtg
ggcacagtggccacttttaaccatggcatcgcccagactcataccactctgagcagccag
gctctacagcctcggcctgtgtcccagcaagaacttgttgctcccacaggggcaccggct
gctcccccgactaatgctgcacctcctgccgctccgccgcccccacctccacacctgaac
cccgagatcacgccgctgtcagccgctctggctcagaccatcgcccaggggatggcaccc
ccacctgtttccatggcccctgtagctgtgtctgtggctcctgtggctcctgtggctgtg
tccatggcccagcccttagcaggaatcacaatgagccacaccactactcctatggtgact
taccccattgcttcccagagcatgcgcatcacagccatgccacactga

DBGET integrated database retrieval system