KEGG   Mus musculus (house mouse): 103554
Entry
103554            CDS       T01002                                 
Symbol
Psme4, TEMO, mKIAA0077
Name
(RefSeq) proteasome (prosome, macropain) activator subunit 4
  KO
K06699  proteasome activator subunit 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    103554 (Psme4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    103554 (Psme4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA200
    103554 (Psme4)
SSDB
Motif
Pfam: BLM10_mid DUF3437 HEAT HEAT_2 CLASP_N Filament
Other DBs
NCBI-GeneID: 103554
NCBI-ProteinID: NP_598774
MGI: 2143994
Ensembl: ENSMUSG00000040850
UniProt: Q5SSW2
Position
11:30721753..30831150
AA seq 1843 aa
MEAPERAGGGEPPEPGGRPVLGPRAFVPQKEIVYNKLLPYAERLDAESDLQLAQIKSNLG
RAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFA
RLLINLLKKKELLSRDDLELPWRPLYDLVERILYSKTEHLRLNSFPNSIENVLKTLVKSC
RPYFPADSTAEMLEEWRPLMCPFDVTMQKAISYFEIFLPTSLPPELHHKGFKLWFDELIG
LWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQVLVPR
FLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWLNKLMKLLQRL
PNSVVRRLHRERFKKPSWLTPVPESHKLTDEDVTDFVQCIIQPVLLAMFSKTGSLEAAQA
LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLNCVIGVARSLVSGSKWFPEGPTH
MLPLLMRALPGVDPNDFSKCMITFQFIGTFSTLVPLVDCSSVLQERNDLTEIEKELCSAT
AEFEDFVLQFMDRCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKD
IFMVALQKVFNFSVSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCYGVITQLTMN
DDVLNEEELDKELLWNLQLLSEITRVDGKKLLLYREQLVKILQRTLHLTCKQGYTLSCNL
LHHLLRSTTLIYPTEYCSVPGGFNKPPSEYFPVKDWGKPGDLWNLGIQWHVPSSEEVSFA
FYLLDSFLQPELIKLQCCGDGELEMSRDDILQSLTIVHSCLIGSGNLLPPLKGEAVTNLV
PSMVSLEETKLYTGLEHDLSRENYREVIASVIRKLLSHILDNSEDDTKSLFLIIKIIGDL
LHFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEY
KKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRKDVT
QQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPALVSSGLSQAMSLEKPSIVRLFDDLA
EKIHRQYETIGLDFTIPKSCAAIAELLQQSKNPSISQTLLSPEKIKEGQKRQQDKNADAL
RNYECLVNTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFVENLNHDAIVV
RKMAISAVAGILKQLKRTHKKLTINPYEISGCPKPTKILAGDRPDNHWLHYDSKNIPRTK
KEWESSCFVEKTHWGYYNWPKNMVVYAGVEEQPKLGRSREDMIEAEQIIYDRFSDPKFVE
QLITFLSLEDRKGRDKFSPRRFCLFKGIFRNFDDAFLPVLKPHLERLVADSHESTQRCVA
EIIAGLIRGSKHWTFEKVEKLWELLCPLLRTALSNMTVETYNDWGTCIATSCESRDPRKL
HWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKN
VRERIGSVLTYIFMIDVSLPNTAPTTSPCIPEFTARVLEKLKPLTDVDEEIQNHVMEENG
IGEEDERTQGIKLLKTILKWLMASAGRSFSTAVKEQLQLLPLFFKIAPVENDNSYDELKR
DAKLCLSLMSQGLLYPQQVPLILQVLSQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE
DAVKDIRWLIICLLEDEQLEVREMAATTLSGLLQCNFLTMDSAMQIHFEQLCKTKLPKKR
KRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEM
TVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
NT seq 5532 nt   +upstreamnt  +downstreamnt
atggaggctccggagcgggcgggcggcggggagccccccgagcctggcgggcggccggta
ctgggcccgcgggccttcgtcccgcagaaggagatcgtgtacaacaagcttctgccctat
gccgagcggctggacgccgagtccgacttgcagctggcacagatcaagagcaacctgggc
cgggccgtgcagctccaagagctgtggcccgggggcctcttctggacgcggaaactctcc
acttatatccgactttatgggagaaaatttagcaaagaagatcatgttctttttattaag
ttactgtatgagctggtatcaattccaaaactagaaatcagcatgatgcagggatttgcc
cgtctcttgatcaacttgttaaaaaaaaaggaacttctttcaagagatgatttagagtta
ccttggagaccactttatgacttggtagaaagaatattatattccaagacagagcacctg
agattaaattcatttcctaattctatagaaaatgttctcaaaacactggtgaaaagctgc
cgaccatactttccagcagattcaacagcagaaatgttagaagaatggcggcctttaatg
tgtccttttgatgtaacaatgcaaaaggccatcagttattttgaaatatttcttcctacc
tcccttcctccagaactgcatcataaaggttttaaactttggtttgatgaattaattggc
ctttgggtttcagtgcaaaatctcccacagtgggaggggcaattagtaaatctctttgct
cgattggctacagataatataggatacatagattgggatccatatgtaccgaagatattt
acaagaattctgagaagcctgaacctcccagtgggaagcagtcaagttttagtcccaaga
tttttaacaaatgcttatgatataggacatgctgtaatatggatcaccgcaatgatgggt
ggaccaagtaaattagtacaaaaacatttagctggtttgtttaacagcatcacatcattt
tatcatccttcaaataatgggcgttggctgaacaagttaatgaaactccttcagcggttg
ccaaacagtgttgttaggagattacatcgtgaaagattcaagaagccctcctggttaact
cctgtgcctgaaagccataagcttactgatgaagatgttacagactttgtacaatgcatt
attcagcctgtcctcttggctatgtttagcaaaactggtagtctagaagcagcccaggct
ctgcagaaccttgcacttatgagacctgagttagtaataccccctgtgcttgaaagaaca
taccctgctttagagacattaacagaacctcaccagctcacagctactttaaattgtgta
attggagtagcccgaagtttggtatcaggcagcaaatggtttcccgaagggccaacacac
atgctacctctgttgatgagagcattgcctggggtagatccaaacgactttagtaagtgc
atgatcacattccaatttataggaacattttctactctggtgcctttagtagactgttca
tctgtactgcaagaaagaaatgacctcacagaaattgaaaaagaactttgttcggcaaca
gctgaatttgaggattttgtgttacaatttatggacagatgctttggactaatagaaagt
agtacattggagcaaacaagggaagagacagaaacagagaaaatgactcatttggagagt
ttggttgaattaggcttatcttctacgtttagtacaatcctcacacaatgttccaaagac
atatttatggtggcccttcagaaggtctttaacttttctgtttcacatatatttgaaaca
agagttgcaggtcgcatggtggcagacatgtgccgagctgctgtgaagtgttgcccagaa
gaatccctgaagctgtttgttccccactgctatggtgttataactcagcttacaatgaat
gatgatgtattgaatgaagaagagctagacaaggagttgctgtggaaccttcagcttctg
tctgagattactcgtgtagacgggaagaagttacttctgtatagggagcagcttgtaaag
attctccagcgaaccttacacctgacctgtaagcagggctacacgctgtcttgcaacctt
ctgcatcatcttcttcgttctaccacactaatctaccctacagagtactgcagtgttccg
gggggctttaacaagccgccttctgaatacttccctgtcaaggactggggtaagcctgga
gatttgtggaatctggggatccagtggcatgttccttcttcagaagaagtctcttttgcc
ttctatttgttagactcctttcttcagcctgagcttatcaaactccagtgttgtggagat
ggagaacttgaaatgtctagagatgatattctacagagtctgactatagtacacagctgc
ttgattggttcagggaaccttctacctccattgaaaggagaggcagttactaacttggta
ccaagtatggtctccttagaggaaacaaaattgtataccggactggaacatgacctatcc
agagaaaactaccgagaagtaattgctagtgtcataaggaaacttcttagccacatactt
gataattcagaagatgataccaaatcactgtttctcatcataaagatcattggagacctt
ctgcacttccaaggatctcataaacatgaatttgactctcgatggaaaagctttaactta
gtaaagaaatcaatggaaaatcggctccatggaaaaaagcaacatatcagagcattacta
attgacagagtgatgctgcagcatgagttgcgaacactaactgttgagggttgtgagtac
aaaaaaatacatcaagatatgatcagagatcttcttcgattatcaacaagctcatacagt
caggtcagaaacaaagctcagcaaacattttttgctgctttgggggcatataacttctgt
tgcagagatattatccccttggttttggaattcctacggcctgatagaaaggatgtcaca
cagcagcagttcaagggcgccttatattgtctacttggaaatcacagtggtgtgtgcctg
gcaaaccttcatgattgggactgtattgtgcagacctggccagcacttgtttcttcaggg
cttagccaagcaatgtcactggaaaagccatcaatagtgagactatttgatgaccttgct
gaaaagattcatagacaatatgaaacaattggcttggattttacaattccaaagtcatgt
gctgcaatagcagaattacttcaacaatcaaagaatccttccattagccagacactactt
agcccagaaaagattaaagaaggacagaagcgtcaacaagataagaatgctgatgcccta
aggaactatgaatgtttggtaaatactttactagatggtgtggagcaaagaaatctgcct
tggaaatttgagcatataggaatcgggcttctgtctctactcctaagggatgacagagtg
ttgcctcttcgtgccatacgtttttttgttgaaaatctcaaccatgatgcaattgttgtt
cgaaagatggctatctcagctgttgctggtattctcaagcagctaaagagaactcacaaa
aagctgactatcaacccttatgaaatcagtggatgtcctaaacctaccaaaattcttgct
ggtgatagacctgataaccattggttgcattatgatagtaaaaatataccaagaacaaaa
aaagaatgggagtcaagttgctttgttgaaaaaactcactggggatactacaactggcca
aagaatatggttgtttatgctggtgtggaagaacagcctaaacttggcagaagcagggag
gatatgatagaggcagaacagattatatatgatcgtttttctgatcctaagtttgttgag
cagttaatcacatttctatctttagaagacagaaaaggaagagataagtttagtccccgg
cgtttctgcctctttaagggtatatttagaaattttgatgatgcttttctgcctgttctg
aagccccatttagaacgtttggttgcagattctcatgaaagtacccagagatgtgttgca
gaaattatagctggtttaatcagaggttctaagcattggacgtttgagaaggtggagaag
ctttgggagctcctgtgcccgctgctgagaacggcactgtccaacatgacagtggagaca
tacaatgactgggggacctgtatagccacttcctgtgaaagcagagatccccggaagctt
cactggctttttgagctgctcttggagtcaccattgagtggtgaaggggggtcctttgta
gatgcatgccgactctatgtgctacaaggtggccttgcccagcaagagtggagagtccct
gaactattgcacagacttctgaagtacttggaaccaaaactcacccaggtttacaaaaat
gtcagagaaagaataggaagtgtgctgacctacatatttatgatagatgtttctttgcca
aatactgctccaacaacatctccttgtatccctgagtttactgctcgcgtcctagaaaaa
ctgaaaccactcacagatgtggatgaagaaattcagaaccatgttatggaagaaaatggc
attggtgaagaagatgaacgaactcagggcattaaactcttaaaaactatattgaaatgg
cttatggcaagtgcaggaagatctttttctacagcagtcaaagagcaacttcagcttctg
cctttgttctttaagatcgctccagtggaaaatgacaatagttatgatgaactgaaaaga
gatgcaaagctctgtttgtcactaatgtctcaggggttgctgtaccctcaacaagtgcct
ttgatacttcaggtgctaagccagacagcaagaagcagttcttggcatgcaagatataca
gtgctgacctacctccagaccatggtattttataacctctttattttcctaaacaatgaa
gatgcagttaaagacatcagatggctgattatatgccttttggaggatgaacagttagag
gttcgagaaatggctgctaccaccttaagtggtctgttacagtgtaacttccttaccatg
gacagtgctatgcagattcattttgagcaactttgcaaaacaaaactacccaagaaaaga
aaacgagaccctggttctgtgggagataccattccttctgcagagttggtcaaacgtcat
gctggtgtgcttggacttggtgcatgtgttctttctagcccttatgatgttcctacctgg
atgccccagctccttatgaacctcagtgcacatttgaatgatcctcagcctattgagatg
actgtaaagaagaccttatccaatttccgaaggacacatcatgacaactggcaagaacac
aagcagcagttcactgatgaccagctgcttgtcctcactgacctccttgtgtcaccatgc
tattatgcatag

DBGET integrated database retrieval system