KEGG   Mus musculus (mouse): 103737
Entry
103737            CDS       T01002                                 

Gene name
Pex12, AI451906, OTTMUSCASG00059419, OTTMUSPWKG00059404
Definition
(RefSeq) peroxisomal biogenesis factor 12
  KO
K13345  peroxin-12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103737 (Pex12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    103737 (Pex12)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    103737 (Pex12)
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-C3HC4 DZR_2 Bombinin zf-C3HC4_4
Other DBs
NCBI-GeneID: 103737
NCBI-ProteinID: NP_598786
MGI: 2144177
Ensembl: ENSMUSG00000018733
Vega: OTTMUSG00000000912
UniProt: Q8VC48 Q5SWQ8
Position
11; 11 C
AA seq 359 aa
MAEYGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFLWRWFD
EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPHLQRPASAGLPKEHLWKSAMFL
VLLPYLKVKLEKLASSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLTQQLR
YILGKAEHHSPLLKLAGVRLARLTAQDMQAIKQRLVEASAMQEPVRSVGEKIKSALKKAV
GGVALSLSTGLSVGVFFLQFLDWWYSSENQEAIKSLTALPTPPPPVHLDYNSDSPLLPKM
KTVCPLCRKTRVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctgagtatggggctcacatcacaactgcttcagtggcggacgaccagccatccatc
tttgaggtggtagcacaggacagtttaatgacagcagtgagacccgctcttcagcatgtg
gtcaaggttcttgcagaatcaaatcctgcgcactatggcttcctctggcggtggtttgat
gaaatcttcactctgctagacttcctgctccagcagcattatctttctagaactagtgcc
tcattttctgaacacttttatggcttaaagcggattgtggcagggagctcgccgcatctt
cagagaccggccagtgctggtcttcccaaggaacacctctggaaatctgccatgttcctt
gtccttcttccctatctgaaagtgaagctagagaagctggcttctagcttgagagaagaa
gacgaatactctattcaccccccttcttctcgctggaaacgattctacagagcctttctg
gcggcctacccttttgttaacatggcctgggaaggctggtttcttacacaacaactgcgt
tacatcttggggaaagctgagcatcactctcccctgctgaaactggctggagttcggtta
gctcgactgacagctcaggacatgcaagctatcaaacagagactggttgaagccagtgca
atgcaggagcccgtcagaagcgttggtgagaagataaagtcagctctgaagaaagctgtg
ggaggtgttgccttatccctctcgactggcctctctgtgggtgtattcttcctgcagttt
cttgactggtggtactcttctgagaaccaagaagccatcaaatcactgactgccctgccc
actccaccaccacctgtacacctagactacaactctgattctcccctcttacccaaaatg
aaaacagtgtgcccactctgtcgtaaaactcgagtgaatgatacggttcttgccacctct
ggctatgtattctgttaccgctgtgtgtttaattatgtgaggagtcaccaagcctgtccc
attacagggtatccaacagaagtccagcatctaattaaactctactctccagagaactga

DBGET integrated database retrieval system