KEGG   Mus musculus (mouse): 103742
Entry
103742            CDS       T01002                                 

Symbol
Mien1, 1810046J19Rik, AI463380, Rdx12
Name
(RefSeq) migration and invasion enhancer 1
  KO
K07401  selenoprotein W-related protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    103742 (Mien1)
SSDB
Motif
Pfam: Rdx
Other DBs
NCBI-GeneID: 103742
NCBI-ProteinID: NP_079835
MGI: 1913678
Ensembl: ENSMUSG00000002580
Vega: OTTMUSG00000006365
UniProt: Q9CQ86
Position
11:complement(98328534..98349056)
AA seq 115 aa
MSGEPAPVSVVPPPGEVEAGSGVHIVVEYCKPCGFEATYLELASAVKEEYPGIEIESRLG
GTGAFEIEINGQLVFSKLENGGFPYEKDLMEAIRRASNGEPVEKITNSRPPCVIL
NT seq 348 nt   +upstreamnt  +downstreamnt
atgagtggggagccagcgccggtgtccgtagtgccccctcccggggaggtggaagcaggc
agtggagtccacatcgtggtggagtactgtaaaccctgcggctttgaggcgacctacctg
gagctggcgagcgctgtgaaggaggagtatccgggcattgagattgagtcgcgactcggg
gggacaggggccttcgagattgagatcaatggacagctggtgttctccaagctggagaat
ggagggtttccttatgagaaagacctcatggaagccatccgaagagccagcaatggagaa
cctgtagaaaagatcaccaacagccggcctccctgtgtcatcctgtga

DBGET integrated database retrieval system