KEGG   Mus musculus (mouse): 103836
Entry
103836            CDS       T01002                                 

Symbol
Zfp692, AI746306, AI839920, Zfp692-ps, Znf692
Name
(RefSeq) zinc finger protein 692
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-C2HC_2 zf-C2H2_aberr zf-C2H2_jaz
Other DBs
NCBI-GeneID: 103836
NCBI-ProteinID: NP_001035776
MGI: 2144276
Ensembl: ENSMUSG00000037243
Vega: OTTMUSG00000005728
UniProt: Q3U381
Position
11; 11 B1.3
AA seq 531 aa
MASPVADASRRRREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDRY
TSSGCVLCAAPEPGPRKGLQYLVLLSHTHSRECGLVPGLRGPGGGEGELVWECSAGHTFS
WEPSLIPAPSDVPKQAPLTHTTERAWCSEARRKQEAQGLECEQRERTQETRLSRRVDSPL
EIDPPLGEDQDVEEEEEEEEEEEELLSDASPWTYSSSPDDSEPDVPRPPPSPVTHTPKEG
EVSPVPATLPTPCAVLASVGSPDALTSDTEVRLELSRTPQVPAELHMTESLESPGSQAQS
APNPTWDEDTAQIGLRRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFCC
PEPACGKSFNFKKHLKEHVKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCEI
CGFTCRQKASLNWHRRKHAETAAALRFPCEFCGKRFEKPDSVVAHCSKSHPALLPAQEPP
GSLVSSPSISAPESLQSPEGASISTTSDSNPASSTSISSPGVPDPRNREKS
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcctctccggtggcagacgcatcccgccgccggcgggagaagcgcaggcagctggac
gcgcgccgcagcaagtgccgcatccgcctgggcggccacatggaacagtggtgcctcctc
aaggagcggctgggcttctccctgcactcgcagctcgccaagttcctgttggaccggtac
acttcttcaggctgtgtcctctgtgcagctccagagcctgggcctcggaagggtctgcag
tacctggtgctcctgtctcacacacacagccgggaatgcggcctagtgcccgggctccgg
gggcctggaggtggtgaaggagagcttgtatgggagtgctctgcgggccacacgttctcc
tgggaaccctctttgattcctgcaccttcagatgtacctaagcaggcccctctcacacac
accacagagagagcctggtgttcagaggccaggaggaagcaggaagcccaaggtttggaa
tgtgagcagcgagaaaggactcaagaaaccaggctgtccaggagagtagattctccattg
gagatcgacccacctctgggagaggatcaggatgtggaggaggaggaggaagaagaagag
gaagaggaagagctgctcagtgacgccagcccatggacctacagctcctccccagatgac
agtgaaccagacgtccctaggccacctccgtcccctgttacgcacacacctaaggaggga
gaggtctcgccagtacctgcaactctgcccactccctgtgctgttctcgcctccgtgggt
tctccagatgctctgacatcagatactgaggtgcggctggaactcagcaggacccctcag
gtgcctgcagagctgcacatgactgagtctctggagagccctgggagtcaggcccagtct
gctccgaatccgacttgggatgaggatactgcccagattgggctcaggagaattaggaaa
gctgccaaaagagagctgatgccctgcgacttccctggctgtggaaggatcttctccaac
cggcagtatctgaatcaccacaagaagtaccagcatatccaccagaagtcgttctgctgc
cctgagccagcttgtgggaagtccttcaactttaaaaagcacctgaaggagcatgtgaaa
ctccacagcgataccagggactacatctgtgaattctgtgctcgatctttccgcactagc
agcaaccttgtcatccacagacgaatccacacaggagagaaacccctgcagtgtgagata
tgtggatttacttgccggcagaaggcctccctaaactggcaccgacgcaagcatgcagag
acagcagctgccctgcgattcccctgtgaattctgtggcaaacgctttgagaagccagac
agtgtggtagctcactgtagcaaaagccacccagccctgctcccagcacaagagccacct
ggctctttggtgtctagtcccagcatttctgcccctgaatccctgcagtctcctgagggg
gctagcatctctaccacttctgactctaatcctgcctcctcaacatccatttcttcacct
ggggtgccagaccccaggaacagagagaaaagttag

DBGET integrated database retrieval system