KEGG   Mus musculus (mouse): 103889Help
Entry
103889            CDS       T01002                                 

Gene name
Hoxb2, AI894218, Hox-2.8, Hoxbes2
Definition
(RefSeq) homeobox B2
  KO
K09302  homeobox protein HoxA/B2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    103889 (Hoxb2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    103889 (Hoxb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox
Motif
Other DBs
NCBI-GeneID: 103889
NCBI-ProteinID: NP_598793
MGI: 96183
Ensembl: ENSMUSG00000075588
Vega: OTTMUSG00000001779
UniProt: P0C1T1
Position
11 D; 11 59.85 cM
AA seq 354 aa AA seqDB search
MNFEFEREIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPLEQTFPSLQLGA
STLQRPGSQKQAGDGPALRSPPPLPVAPPAPEFPWMKEKKSTKKPSQSAASPSPAASSVR
ASEVGSPSDGPGLPECGGSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDL
TERQVKVWFQNRRMKHKRQTQHREPPEGEPGGPSAQDDAGEPAEEPTVSPGDVATHRLRE
ACFHPAEAAQGPRGAPPSALPATTLESVGASSPGCTMLRAGGRQSEPLPEDACPERQDSP
FLPDLNFFAADSCLQMSGGLSPSLQGSLDSPVPFSEEELDFFTSTLCAIDLQFP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaatttgagagggagattgggtttataaacagccagccatcgctcgccgag
tgtctgacttccttccccgctgtcttggagacatttcaaacttcatcaatcaaggagtcg
acattaattcctcctcctcctcctctggagcaaaccttccccagcctccagctcggcgcc
tccacccttcagagaccagggagccaaaagcaagccggagatgggcctgctctgcggtca
ccgccgccactccccgttgcccccccagcccccgagttcccctggatgaaagagaagaaa
tccaccaagaaacccagccaatccgccgcatccccttctccagccgcctcctcggtccgg
gcctccgaggtcggatcaccatcagatggccccggattgccagaatgcggcggcagcggc
tcccgcagactgcgcacggcctacaccaacacgcaactgctggagctggagaaggagttc
cacttcaataagtacctgtgccggccgcgtcgcgtcgagatcgctgccttgctggacctc
accgaaaggcaggtcaaagtctggttccagaaccgacgcatgaaacacaagcggcagacg
cagcatcgagagccgcccgagggagaaccaggcgggccgagcgcccaggacgacgcggga
gagccagccgaggaacccacggtcagcccgggcgacgtcgcgactcaccggctgcgggaa
gcctgcttccaccccgccgaggccgcgcagggaccccggggcgcaccgccgtcagcgctg
cctgccaccaccctggagagtgtgggcgcatcgagccccggctgcacaatgctcagagcc
ggaggccggcagagcgagcccctacccgaagacgcctgccccgagcggcaggattcgcct
tttctaccggacctcaatttcttcgctgcagactcctgtctccagatgtccggaggcctt
tcacccagcctgcagggttctctcgatagccccgtgcccttttccgaggaagagctggac
ttcttcaccagcacgctctgtgccatcgacttgcagtttccctaa

DBGET integrated database retrieval system