KEGG   Mus musculus (mouse): 103963
Entry
103963            CDS       T01002                                 

Gene name
Rpn1, AU018702, D6Wsu137, D6Wsu137e, Rp, Rpn-1
Definition
(RefSeq) ribophorin I
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103963 (Rpn1)
   00513 Various types of N-glycan biosynthesis
    103963 (Rpn1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103963 (Rpn1)
SSDB
Motif
Pfam: Ribophorin_I FliD_C CtIP_N DNA_repr_REX1B
Other DBs
NCBI-GeneID: 103963
NCBI-ProteinID: NP_598694
MGI: 98084
Ensembl: ENSMUSG00000030062
Vega: OTTMUSG00000057340
UniProt: Q91YQ5 Q5RKP4 Q8BMR3
Position
6 D1; 6 39.13 cM
AA seq 608 aa
MESPVALLLLLLLCLGALAPTPGSASSEAPPLVNEDVKRTVDLSSHLAKVTAEVVLVHPG
GGSTSRASSFVLALEPELESRLAHLGVQIKGEDEEDNNLEVRETKIKGKSGRFFTVKLPV
ALDPGSKISVVVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLAS
RNVESYTKLGNPSRSEDVLDYGPFKDIPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHW
GNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGN
VSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHV
FDEQVIDSLTVKIILPEGAKNIQVDSPYDISRAPDELHYTYLDTFGRPVIVAYKKNLVEQ
HIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACIT
EQVLTLVNKRLGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKAVTSEIAVLQSRLKT
EGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYLENEKLSSGKRQELVTK
IDHILDAL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggagtcgccggtcgccttgctgttgctgctgctgctatgtctcggggccttggccccg
acgcccggcagcgcctcctcggaggctccgccgctggtcaacgaggacgtgaagcgcacg
gtggacctgagcagccacctagccaaggtgacggctgaggtggtcctggtacacccgggc
ggcggctccacatcacgagccagctctttcgttctggccctggagccagaactggagtcg
cggcttgcgcacctaggcgtgcagataaagggagaagatgaggaagacaacaacctagaa
gtacgagaaaccaaaattaaagggaaaagtgggagatttttcacggtcaagctcccagtt
gctcttgatcctgggtccaagatctcggtcgttgtggaaactgtctacacccatgtgctt
catccgtatccgactcagataactcagtcagagaaacagttcgtcgtgtttgagggcaac
cattatttctactctccctatccaacaaagacccagaccatgcgagtgaaactggcgtcc
cgaaatgtggaaagctataccaagctggggaacccctcgagatctgaggacgtccttgat
tatgggccttttaaagacatccctgcctacagtcaggacactttcaaagtacattacgag
aacaatagccctttcctgaccatcaccagtatgacccgggtcatcgaggtatctcactgg
ggcaatattgctgtggaagagaacgtggacttgaagcacacgggcgcagtgctgaagggg
cctttctcccgctacgattaccagaggcagcctgacagtgggatctcctccattcgttct
tttaagaccatccttcctgctgccgcccaggatgtctattaccgggatgagattggtaat
gtttccaccagccacctccttatcttggatgactctgtggaaatggaaatccggcctcga
tttcctctctttggagggtggaagacacactacatcgttggttacaacctcccaagctat
gaatacctctataatctgggtgaccagtatgcactgaagatgcggtttgtagaccacgtg
tttgatgagcaagtgatagattctctgacagtgaagatcatcttgcccgagggagccaag
aacatccaggtggacagtccctacgatatcagccgggccccagacgagctgcattatacc
tacctagacacgttcggccgcccggtgattgtggcttacaagaagaatctcgtcgagcaa
cacattcaggacattgtggtgcactacacgttcaacaaggttctcatgctgcaggagccg
ctgctggtcgtggccgccttctacatcctgttcttcaccgtcatcatctacgtccgtctg
gacttttccatcaccaaggatccagctgcagaagccaggatgaaagtggcctgtatcaca
gagcaggtcttaaccctggtcaacaagaggctgggcctctaccgtcactttgatgagact
gtcaatagatacaagcagtcccgggatatctctaccctcaacagtggcaagaagagccta
gagacagagcacaaggctgtgaccagcgagattgctgtactgcagtctcggctgaagacg
gagggctcagacctgtgtgacagggtgagtgagatgcagaagctggacgcccaggtcaag
gagctggtcctgaagtcggcggtagaagcagagaggctggtggctggcaagctcaagaag
gatacgtacctggaaaacgagaagctcagctcaggaaaacgccaggagctggtcaccaag
atcgaccacatcctggatgctctgtag

KEGG   Mus musculus (mouse): 13135
Entry
13135             CDS       T01002                                 

Gene name
Dad1, AI323713
Definition
(RefSeq) defender against cell death 1
  KO
K12668  oligosaccharyltransferase complex subunit epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    13135 (Dad1)
   00513 Various types of N-glycan biosynthesis
    13135 (Dad1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13135 (Dad1)
SSDB
Motif
Pfam: DAD
Other DBs
NCBI-GeneID: 13135
NCBI-ProteinID: NP_001106829
MGI: 101912
Ensembl: ENSMUSG00000022174
Vega: OTTMUSG00000033740
UniProt: P61804
Position
14 C2; 14 27.7 cM
AA seq 113 aa
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
NT seq 342 nt   +upstreamnt  +downstreamnt
atgtcggcgtctgtggtgtccgtcatctcccggttcctggaggagtacttgagctccact
ccgcagcggctgaagttgctggacgcctatctcctttatatactgctgaccggggcgctg
cagttcggctactgtctcctcgtgggcaccttccccttcaactctttcctctctggcttc
atctcttgtgtgggcagcttcatcctagcggtttgcctgagaatacagatcaacccccag
aacaaggcggacttccaaggcatctctccggagcgagcctttgctgacttcctctttgcc
agcacgatcctgcaccttgtcgtcatgaacttcgttggctga

KEGG   Mus musculus (mouse): 13200
Entry
13200             CDS       T01002                                 

Gene name
Ddost
Definition
(RefSeq) dolichyl-di-phosphooligosaccharide-protein glycotransferase
  KO
K12670  oligosaccharyltransferase complex subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    13200 (Ddost)
   00513 Various types of N-glycan biosynthesis
    13200 (Ddost)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13200 (Ddost)
SSDB
Motif
Pfam: DDOST_48kD
Other DBs
NCBI-GeneID: 13200
NCBI-ProteinID: NP_031864
MGI: 1194508
Ensembl: ENSMUSG00000028757
Vega: OTTMUSG00000009976
UniProt: O54734
Position
4; 4 D3
AA seq 441 aa
MKMDPRLAVRAWPLCGLLLAVLGCVCASGPRTLVLLDNLNVRDTHSLFFRSLKDRGFELT
FKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIG
DPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPI
LFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARV
IFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHR
VGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKY
SVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSM
MAGLFIFSIVFLHMKEKEKSD
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaagatggatccccgcctcgccgtccgcgcctggcccctctgcgggctgctgctggcc
gtgctcggctgcgtctgcgccagcggcccccgcaccctcgtgctgctggacaacctgaac
gtgcgggacacgcactcgctgttcttccgcagcctgaaggaccggggctttgagctcacc
ttcaagaccgcagatgaccccagcttgtccctcattaagtacggggagttcctctatgac
aaccttatcatcttttccccgtcggtggaagattttggaggcaacatcaacgtggagacc
atcagtgccttcattgatggtggcggcagcgttttggtggctgccagctctgatattggt
gaccctcttcgggagctgggcagtgagtgtgggattgaatttgatgaagagaaaacagct
gtcatcgaccaccacaactatgatgtttctgaccttggccagcacacactcattgtggct
gacactgagaacctgctgaaggccccgaccattgttggcaagtcatctctgaaccccatt
ctcttccgaggagttggaatggtggcagacccggacaatcccttggttttggacatccta
acaggctcttcaacctcttactccttcttcccagataaaccaatcacccagtacccccat
gcggtggggaggaacactctgctgattgccgggctccaggccaggaacaacgcccgggtc
atcttcagtggctctctggatttcttcagcgatgccttcttcaactcggcagtgcagaag
gccacacccggtgcgcagaggtattctcagacaggcaactatgaactagctgtggccctc
tcacgctgggtgttcaaggaggagggtgtccttcgagtagggcctgtgtcccatcaccgg
gtgggcgagatggctccacccaatgcctacactgtcaccgacttggtggagtatagcatc
atcatagaacagctctccaatggcaagtgggtcccctttgatggtgatgacattcagctg
gagttcgtgcgcatcgaccccttcgtgaggaccttcctgaagaggaaaggtggcaagtac
agtgtccagttcaagctgcctgacgtgtatggtgtattccagtttaaagtggattacaac
cggctaggctacacccacctgtactcttccacccaggtgtcagtgaggccactccagcac
acgcagtatgagcgcttcatcccctcggcctatccctactatgccagtgccttctccatg
atggccgggctcttcatcttcagcatcgtcttcttgcacatgaaggagaaggagaagtct
gactga

KEGG   Mus musculus (mouse): 16430
Entry
16430             CDS       T01002                                 

Gene name
Stt3a, AA408947, B5, BB081708, Itm, Itm1
Definition
(RefSeq) STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae)
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    16430 (Stt3a)
   00513 Various types of N-glycan biosynthesis
    16430 (Stt3a)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    16430 (Stt3a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    16430 (Stt3a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     16430 (Stt3a)
Glycosyltransferases [BR:mmu01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   16430 (Stt3a)
SSDB
Motif
Pfam: STT3 PMT_2 DUF2985
Other DBs
NCBI-GeneID: 16430
NCBI-ProteinID: NP_032434
MGI: 105124
Ensembl: ENSMUSG00000032116
Vega: OTTMUSG00000031806
UniProt: P46978 Q3U573
Position
9 A4; 9 20.67 cM
AA seq 705 aa
MTKLGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFL
AEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLA
PLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY
YMWIKAVKTGSIYWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAY
CTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSY
YFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTS
EAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTI
LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
RIGGSTETGRHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGF
DRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgactaagcttggatttttgcgattgtcctatgagaagcaggacacacttctaaagctt
ctcatcctgtcgatggctgctgtgttatctttttctactcgtctttttgctgtgctgaga
tttgaaagtgtcatccatgagtttgatccgtactttaattatcggactacccggtttctg
gctgaggaggggttttataaattccataactggtttgatgaccgggcttggtaccctttg
ggccgaatcattggaggaacaatttacccaggtttaatgatcacttctgctgcaatctac
catgtactccatttcttccatatcaccattgacattcggaatgtctgtgttttcctggcc
ccgcttttctcctctttcaccaccatcgttacgtaccaccttaccaaagagctcaaggat
gcaggagctgggcttcttgctgctgccatgattgctgtagttcctgggtatatttctcga
tctgtagctggctcctatgataatgaaggaattgctatcttttgcatgctgcttacttac
tacatgtggatcaaggcagtgaagactggttccatctattgggctgccaagtgtgccctc
gcttatttctacatggtctcttcatggggaggctatgtgttcctgatcaacttgattcct
ctacatgtcctggtgctaatgctgacaggccgtttttctcaccggatctacgtagcctac
tgtactgtttactgcctgggcaccattctttctatgcagatttcctttgttggtttccag
cccgtcctttcatcagaacacatggcagcctttggagtgtttggtctctgtcagatccat
gctttcgtagattacctgcgcagcaagttgaatccacagcaattcgaagttcttttccgg
agtgttatctccctggttggctttgtcctcctcactgtgggagctctcctcatgctaaca
ggaaaaatttctccctggacagggcgtttctactctctgctggatccctcttatgctaag
aataacattcccattattgcatctgtttctgagcaccagcccacaacctggtcttcctac
tattttgatctacagctccttgtcttcatgtttccagttggcctctattactgctttagc
aacctgtctgatgctcggatttttatcatcatgtatggtgtgaccagcatgtacttttca
gctgtaatggtgcgtctaatgctggtattggcacctgttatgtgcattctttctggcatt
ggtgtttcccaggtgctgtccacatatatgaaaaatctggacataagtcgcccagacaag
aagagcaagaagcaacaggattctacttaccctattaagaatgaggtggcgagtgggatg
atactggtcatggctttctttctcatcacctacacgtttcattcgacttgggtgaccagt
gaagcctattcttctccctccattgttctgtctgctcgtggtggggatggcagtaggatc
atttttgatgacttccgagaagcgtattattggctccgtcacaatactccagaggatgca
aaagtcatgtcatggtgggattatggctaccaaattactgcaatggcaaatcggacaatt
ttagtggacaataacacatggaataatacccatatttctcgagtagggcaggcaatggca
tccacagaagaaaaagcctatgaaatcatgagggagcttgatgtcagctatgtgcttgtc
atttttggaggccttactgggtattcttcggatgatatcaacaagtttctttggatggtc
cggattggaggaagcacagagacaggaagacacattaaggagaatgactactatactcct
actggggaattccgtgttgatcgtgagggttctccggtgctgctcaactgccttatgtac
aaaatgtgttactaccgctttgggcaggtctacacagaagccaagcgtccaccaggcttt
gaccgtgttcgaaatgctgagattggtaataaagactttgagcttgatgtcctggaggaa
gcgtataccacagaacactggctagtcaggatatacaaggtaaaggacctggataatcga
ggcttgtcaaggacataa

KEGG   Mus musculus (mouse): 20014
Entry
20014             CDS       T01002                                 

Gene name
Rpn2, 1300012C06Rik, AV261018, Rp, Rpn-2
Definition
(RefSeq) ribophorin II
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    20014 (Rpn2)
   00513 Various types of N-glycan biosynthesis
    20014 (Rpn2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20014 (Rpn2)
SSDB
Motif
Pfam: Ribophorin_II HSM3_N DUF5859
Other DBs
NCBI-GeneID: 20014
NCBI-ProteinID: NP_062616
MGI: 98085
Ensembl: ENSMUSG00000027642
Vega: OTTMUSG00000016167
UniProt: Q9DBG6
Position
2 H1; 2 78.2 cM
AA seq 631 aa
MAPPGSSAVFLLALTITASVQALTPTHYLTKQDVERLKASLDRPFTDLESAFYSIVGLSS
LGVQVPDVKKACTFIKSNLDPSNVDSLFYAAQSSQVLSGCEISVSNETKELLLAAVSEDS
PIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQALQTASHLSQQADLRNI
VEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTI
FSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPL
AQAAVKLEHAKSAATRATVLQKTPFSLVGNVFELNFKNVKLSSGYYDFSVRVEGDSRYIA
NTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQL
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYT
LYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQSLFTPKQEIQHLFREPEKRPPTV
VSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMF
QTLKYLAVLGTVTFLAGNRMLAQHAVKRTAH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcgccgccgggttcaagcgctgtcttcctgttggccctgacaatcactgccagcgtc
caggctctgacccccacccactacctcaccaagcaggatgtggaaaggctgaaggcctca
ctggaccgccccttcacagatttggagtctgccttctactccatcgtgggactcagcagc
cttggggtacaggtgccagatgtcaagaaagcgtgtaccttcatcaagtccaaccttgat
cccagcaacgtggattctctcttctatgcagcccagtccagccaggtcctctcaggctgt
gagatatctgtttcaaatgagaccaaagagctcctgctggcagcagtgagtgaagactcc
cccattgcccagatctaccatgcagttgcagcactcagcgggtttgggcttcccttggca
tccaatgaagccctcggtgcccttaccgctcgcctcggcaaggaagagactgtgctagca
acggtccaggctctgcagacagcgtcccacctctcccagcaggctgacctgaggaacatt
gtagaggagattgaggaccttgttgctcggctggatgaactagggggtgtgtatctgcag
tttgaggaaggactggagctcacggcgctgtttgttgctgccacctacaagctcatggac
cacgtggggaccgaaccgtccatgaaggaggatcaggttatccagctcatgaacacaatc
ttcagcaagaagaactttgagtccctctcagaagccttcagtgtggcctctgctgctgct
gcattgtcccagaatcgctaccacgtaccagtggtggttgtgcccgagggctctacttct
gacactcaagaacaggctatcctgaggttgcaggtcagcaatgttttgtctcagcctctg
gctcaagctgcagtgaagctggagcatgctaagtcggcggctaccagggctaccgtcctg
cagaagacgcccttttcgcttgtggggaatgtttttgagctaaacttcaagaatgttaaa
ctttccagtggctactatgacttctctgtccgagttgaaggtgacagccgttacattgca
aacactgtagagcttcgagtcaagatctccactgaagttggcatcacaaatgttgatctt
tccactgtggataaggatcagagcattgcacccaaaactacccgggtgacctacccagcc
aaagccaagggtacattcatcgcagacagccatcagaactttgccctgtttttccagctg
gtagatgtgaacaccggtgcggagctcacccctcaccagacgtttgttcgacttcataac
cagaagactggccaggaagtggtgtttgttgctgagccagataacaagaatgtatataag
tttgaactggacacctctgaaaggaagattgaatttgactctgcctctggcacctacaca
ctctacttaatcatcggggatgccacattgaagaacccaatcctctggaacgtggctgac
gtggttatcaagttccctgaggaggaagccccctcgactgtgctgtcccagagcctgttt
accccaaaacaggaaattcagcacctgttccgagagcctgagaagaggccccccacagtg
gtgtccaatacattcacggccctcatcctctcgcccttgctcctgctctttgcactgtgg
atccggattggagccaatgtctccaacttcacatttgctcctagcacagttatcttccac
ctgggacatgctgcgatgctgggcctcatgtatatctactggactcagctcaacatgttc
cagaccctcaagtacctggctgtcctgggcactgtgacgtttctggctggcaaccgaatg
ctggcccagcatgcagttaagagaacagcacattag

KEGG   Mus musculus (mouse): 68292
Entry
68292             CDS       T01002                                 

Gene name
Stt3b, 1300006C19Rik, S, Simp
Definition
(RefSeq) STT3, subunit of the oligosaccharyltransferase complex, homolog B (S. cerevisiae)
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    68292 (Stt3b)
   00513 Various types of N-glycan biosynthesis
    68292 (Stt3b)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    68292 (Stt3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    68292 (Stt3b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     68292 (Stt3b)
Glycosyltransferases [BR:mmu01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   68292 (Stt3b)
SSDB
Motif
Pfam: STT3
Other DBs
NCBI-GeneID: 68292
NCBI-ProteinID: NP_077184
MGI: 1915542
Ensembl: ENSMUSG00000032437
Vega: OTTMUSG00000062861
UniProt: Q3TDQ1 A0A0R4J0D3
Position
9; 9 F3
AA seq 823 aa
MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGTQSASRAAAPKPGPPAGLSGGLS
QPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFYEFL
NWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGLTSI
STFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKSVKT
GSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIVGLI
LSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLAAGA
VFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHILVC
TFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVFEHY
LGDDMKRENPPVEDSSDEDDKRNPGNLYDKAGKVRKHVTEQEKPEEGLGPNIKSIVTMLM
LMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHARVMS
WWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRSLDVDYVLVIFGG
VIGYSGDDINKFLWMVRIAEGEHPKDIREGDYFTQQGEFRVDKAGSPTLLNCLMYKMSYY
RFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRETLGH
KPRVTNIVPKQKYLSKKTTKRKRGYVKNKLVFKKGKKTSKKTV
NT seq 2472 nt   +upstreamnt  +downstreamnt
atggcggagccctcggccccggagagcaagcacaagtcgtccctcaactcgtccccgtgg
agcggcctcatggctctggggaacagccgccacgggcaccatgggcccggaacccagagc
gcgtccagggcggcggcgccgaagccggggccccccgcggggctgtccgggggcttgtcg
cagccggccgggtggcagtcgttgctctccttcaccatcctcttcctggcctggctggcc
ggcttcagctcgcgcctcttcgccgtcatccgcttcgagagcatcatccacgagttcgac
ccgtggtttaactatagatcaacacatcatcttgcatctcatggattctatgagtttcta
aattggtttgatgaaagagcatggtacccactgggaagaatagtgggtggcaccgtttac
ccagggttgatgataacagctggccttattcattggattttaaatacattgaacataaca
gttcacataagagatgtgtgtgtattccttgcaccaacttttagcggccttacatccata
tctacgttcctgctaactagagaactgtggaaccaaggagcaggacttctagctgcttgc
ttcattgctatcgtaccagggtacatatctcggtcagtggcgggatcctttgataatgaa
ggcattgccatttttgcgcttcagttcacttactacttatgggtaaagtctgtgaagacc
gggtctgtgttctggacaatgtgctgctgcttgtcatatttctacatggtctctgcgtgg
ggaggttatgtgttcatcatcaacctcatccctctccatgtgtttgtgttgctgctgatg
cagaggtacagcaagagagtctacatagcatatagcactttctacattgtgggtttaata
ttatccatgcagataccttttgtgggatttcagccaatcagaacaagcgagcacatggca
gctgcaggtgtctttgcgctgctgcaagcttacgcttttttgcagtatctgagagaccgg
ttgacaaaacaggagttccagacccttttctttttgggtgtctcactagctgcaggcgct
gtgttccttagtgtcatctatctgacatacacaggttatattgcaccatggagtggcagg
ttttattcactatgggatactgggtatgcaaaaatacacattccaattattgcatcagtg
tctgaacatcagcctacgacatgggtgtctttcttctttgatctacatattcttgtatgt
accttcccagcaggcctatggttctgcatcaaaaatatcaacgatgaaagagtatttgtc
gctctgtatgcgatcagtgctgtctactttgccggagtgatggtgcggctgatgctgact
ctgaccccggtcgtctgcatgctgtcggccatcgccttctccaatgtttttgagcactat
ttgggggatgacatgaaaagggaaaacccacctgtggaggacagcagtgatgaggatgac
aaaagaaacccaggaaacttgtatgacaaggcaggtaaagtgaggaagcatgtgacagag
caagagaaacctgaagagggcttgggccccaacatcaaaagcattgtgaccatgctgatg
ctcatgctcctgatgatgttcgcggtccactgcacgtgggtcacaagcaacgcctactcc
agtccaagtgtggtccttgcctcctacaatcatgatggtaccaggaatatattagatgat
tttagagaagcgtacttttggctgagacaaaacacggatgaacacgcccgggtcatgtcg
tggtgggactacggctatcagattgctggcatggccaacaggaccactctggtggataac
aacacctggaacaacagccacatcgcactggtcggaaaagctatgtcttccaatgaaacg
gccgcctataaaatcatgaggtcccttgatgtcgattatgtgttggttattttcggagga
gtgattggctattccggggacgatatcaacaagttcctctggatggtcaggatagctgaa
ggggagcatcccaaagacatccgggaaggtgactatttcacccagcagggagagttccga
gtagacaaagctgggtctcctactctgttaaactgccttatgtataaaatgtcatactac
agatttggagaaatgcagctagattttcgcactcccccaggctttgaccgaacacgtaat
gctgagattggaaataaagacattaaattcaagcatttggaggaagcttttacatcagag
cactggcttgtcaggatatataaagtgaaagcacctgacaacagggagacactaggtcac
aaacctcgagtcaccaacatcgtccccaaacagaagtatttgtcaaagaagactactaaa
aggaagcgtggctacgttaaaaataagctagtgtttaagaaaggcaagaagacctctaag
aagactgtttaa

KEGG   Mus musculus (mouse): 80286
Entry
80286             CDS       T01002                                 

Gene name
Tusc3, AU022242, BC003311, N33
Definition
(RefSeq) tumor suppressor candidate 3
  KO
K12669  oligosaccharyltransferase complex subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    80286 (Tusc3)
   00513 Various types of N-glycan biosynthesis
    80286 (Tusc3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    80286 (Tusc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    80286 (Tusc3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC58: MagT-like magnesium transporter
   80286 (Tusc3)
SSDB
Motif
Pfam: OST3_OST6 Thioredoxin DUF4131 Gram_pos_anchor
Other DBs
NCBI-GeneID: 80286
NCBI-ProteinID: NP_084530
MGI: 1933134
Ensembl: ENSMUSG00000039530
Vega: OTTMUSG00000061049
UniProt: Q8BTV1
Position
8; 8 A4
AA seq 347 aa
MSARAAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFVKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagtgccagggccgctccttcacgccggagacaggcgggccgccggttgcgctacctg
cctactggtagctttcccttcctcctcttgctgctgctgctctgcatccagctcgggggc
ggacagaagaaaaaggagaaccttttggctgaaaaagtggagcagctgatggaatggagt
tccaggcgctcgatcttcagaatgaacggcgacaagttccggaagtttgtaaaagcccca
cctcggaactactccatgatcgtcatgttcactgctctgcagcctcagcggcagtgttct
gtgtgcaggcaggctaacgaagaatatcaaatcctggctaattcctggcgttattcatct
gctttttgcaacaaactgttttttggaatggtggactatgatgaagggacagatgttttt
caacagctcaacatgaactccgctcccacattcatgcattttccttcaaaaggcagaccc
aagagagctgatacttttgaccttcaacgaattggatttgcagctgagcagctagcaaaa
tggattgccgacaggacggatgttcatattcgagttttccggccacccaactactcaggc
accattgctttggccctgttagtgtcactggttggtggcttgctttatctaaggaggaac
aacttggagtttatctataacaagactggttgggccatggtatctctgtgtatagtcttt
gctatgacgtctggccagatgtggaatcatatccgtggacctccatatgctcataagaac
ccacacaatggacaagtgagctacattcatggaagcagccaggctcagtttgtggcagag
tcacacatcattctagtactgaatgctgctatcaccatggggatggttcttctaaatgaa
gcagcaacttccaaaggggatgtcgggaaaagacgcatcatttgcctcgtgggattgggc
ttggtggtcttcttcttcagttttctcctttcaatatttcgttcaaagtaccatggctat
ccatatagctttttaattaaatga

DBGET integrated database retrieval system