KEGG   Mus musculus (mouse): 103978Help
Entry
103978            CDS       T01002                                 

Gene name
Gpc5, A230034F01Rik
Definition
(RefSeq) glypican 5
  KO
K08111  glypican 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    103978 (Gpc5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    103978 (Gpc5)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   103978 (Gpc5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  103978 (Gpc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican
Motif
Other DBs
NCBI-GeneID: 103978
NCBI-ProteinID: NP_780709
MGI: 1194894
Ensembl: ENSMUSG00000022112
Vega: OTTMUSG00000042137
UniProt: Q8CAL5
Position
14; 14 E4
AA seq 572 aa AA seqDB search
MDARTWRLGWRCLLLLALLGSTRSEGVESCEEVRKLFQWRLGGAVKGLPEAPRAGPDLQV
CLSKNPTCCTRKMEERYQIAARQDLQQVLQTSSSTLKLLISRNAAAFQETLETLIRQAEN
YTSILFCNTYRNMALEAAASIQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLIN
PGVTDSSLQYSECIRMARQDVSPFGNIPKRVMGQMGRSLLPGRTFLQALNLGIEVINTTD
HIHFSKECSRALLKMQYCPHCQSLMLSKPCMGYCLNVIRGCLAHMTELNPHWHAYIRSLE
ELSDAMHGTYDVEHVLLNFHLLVNDAVLQAHLNGQKLLDQVNTICGHPVRTPTQSPRCTF
DPSKEKHGMKISARNGEETLANRRKEFINSLRLHGSFYGGLADQLCVNELAAPEGRPCWN
GEEIVKSYAQRVVGNGIKAQSANPEVRVRGTDPVVNQIIDKLKHVIQLLRGRSPKPNKWE
LLQPGSGGGMLENSSGDCDDEDGCGGSGSGEVKRTLKITNWMPDSMNFSDVKQVHRADHG
STLDTTSTGCASGTESMALPLMGTLMFLPWLW
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccgcacctggcgtctgggctggcgctgtctccttctcctggctctccttgga
tctacccgaagcgagggcgtggagagctgcgaagaagttcggaaacttttccagtggcgg
cttgggggagctgtcaaagggctgccggaggcgccgcgggcaggacctgatcttcaggtt
tgcctatccaaaaacccaacgtgctgtaccaggaagatggaggagaggtaccagattgca
gctcggcaagatttgcagcaggtgcttcagacatccagctcaacattaaagttgctaata
tctcgaaatgcagctgcttttcaagagaccctggaaaccctcatcagacaagcagagaat
tacaccagtatccttttctgcaacacctaccggaacatggccttggaggctgctgcttcc
attcaggaatttttcacggatgttggactctatttatttggtgcggatgttaatcccgag
gaatttgtaaacagattctttgacagtctttttcctctggtctacaaccatcttataaac
cctggtgtgactgacagttctctgcaatactcagaatgcattcgaatggcccgccaggat
gttagtccatttggcaacattcccaaaagagtcatggggcagatggggaggtcgctgctg
cctggccgcacattcttgcaggcgcttaatctgggcattgaggtcatcaacaccacggac
cacatacacttctccaaggagtgcagtagggccctcctgaagatgcagtattgtcctcac
tgccagagcctgatgctcagtaagccctgtatggggtactgcctcaatgtcatcaggggc
tgcctggcccacatgactgagcttaatccacactggcatgcttatatccggtctttggaa
gagttgtcagatgcgatgcacggaacctacgacgttgaacacgtgctcctgaacttccac
ttgcttgttaatgatgccgtgttgcaggctcacctcaatgggcagaaattattggatcag
gtgaatacgatttgtggccatccagtgagaacaccaacacagagcccccgctgtactttt
gacccaagcaaagagaaacatggaatgaagatctctgcaaggaatggtgaagagacactt
gccaacagaagaaaagaattcatcaatagccttaggctgcatgggtccttctatggtggc
ctggctgaccagctttgtgttaatgaattggctgcccctgaaggaaggccctgctggaat
ggggaggaaatagtcaaaagctatgctcagcgtgtggttgggaatggaatcaaagcccag
tctgcaaatcctgaagtcagagtcagaggaaccgatcctgtggtaaatcagatcattgat
aaactgaagcatgtcatccagttgttacgggggagatcacccaagcccaacaagtgggag
ctccttcagccaggcagtggaggcggcatgcttgagaactctagtggagactgtgatgac
gaagatggctgtggaggatcaggaagcggagaagtaaagaggaccctgaagatcacaaac
tggatgccagacagcatgaacttcagtgatgtgaagcaagtccatcgagcagaccatgga
agtactctggatacaaccagcaccggatgtgcgtcaggaactgagtctatggcactccct
ctgatggggacactgatgtttcttccctggctttggtaa

DBGET integrated database retrieval system