KEGG   Mus musculus (mouse): 103988Help
Entry
103988            CDS       T01002                                 

Gene name
Gck, GLK, Gk, Gls006, HK4, HKIV, HXKP, Hlb62, MODY2
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu00524  Neomycin, kanamycin and gentamicin biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04917  Prolactin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04930  Type II diabetes mellitus
mmu04950  Maturity onset diabetes of the young
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103988 (Gck)
   00052 Galactose metabolism
    103988 (Gck)
   00500 Starch and sucrose metabolism
    103988 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    103988 (Gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103988 (Gck)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    103988 (Gck)
   04910 Insulin signaling pathway
    103988 (Gck)
   04922 Glucagon signaling pathway
    103988 (Gck)
   04917 Prolactin signaling pathway
    103988 (Gck)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    103988 (Gck)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103988 (Gck)
   04950 Maturity onset diabetes of the young
    103988 (Gck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     103988 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103988
NCBI-ProteinID: NP_001274315
MGI: 1270854
Ensembl: ENSMUSG00000041798
Vega: OTTMUSG00000006327
UniProt: P52792 Q5SVI6
Position
11 A1; 11 3.88 cM
AA seq 465 aa AA seqDB search
MAVDTTRRGAQSLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDESSVNPGQQLYEKIIGGKYMGE
LVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRRQILNILSTLGLRPS
VADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggatactacaaggaggggagcccagtcgttgactctggtagagcagatcctg
gcagagttccagctgcaggaggaagacctgaagaaggtgatgagccggatgcagaaggag
atggaccgtggcctgaagctggagacccatcaggaggccagtgtaaagatgttgcccacc
tacgtgcgttccaccccagaaggctcagaagttggagactttctctccttagacctggga
ggaaccaacttcagggtgatgctggtgaaagtgggggagggggaggcaggacagtggagc
gtgaagacgaaacaccagatgtattccatccccgaggacgccatgacgggcactgcggag
atgctctttgactacatctctgagtgcatctctgacttcctggacaagcatcagatgaaa
cacaagaaactacccctgggcttcaccttctccttccctgtaaggcacgaagacatagac
aagggcatcctgctcaactggaccaagggcttcaaggcctccggagcagaagggaacaac
atcgtgggacttctccgagatgctatcaagaggagaggggactttgagatggatgtggtg
gcaatggtgaatgacacggtggccacaatgatctcctgctactatgaagaccgccaatgt
gaggtcggcatgattgtgggcaccggctgcaacgcctgctacatggaggagatgcagaat
gtggagctggtggaaggcgatgaggggcgcatgtgtgtcaacacagagtggggcgccttc
gggaactccggtgagctggacgagttcctcctggagtacgaccggatggtggatgagagc
tcagtgaaccccggtcagcagctgtacgaaaagatcattggcggaaagtacatgggcgag
ctggtacgacttgtgctgctcaagctggtagaggagaatcttctgttccacggagaggcc
tcagagcagctgcgcacacgtggtgcttttgagacccgttttgtgtcgcaggtggagagc
gactctggggaccgaaggcagatccttaacatcctgagcactctgggccttcgaccctct
gtcgccgactgcgacattgtgcgccgtgcctgtgaaagcgtgtccactcgcgccgcccac
atgtgctcagcaggactagcgggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcacggtgggcgtggatggctccgtgtacaagctgcacccgagcttcaag
gagcggtttcacgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcattgaa
tcagaggagggcagcggcaggggagccgcactggtctctgcggtggcctgcaagaaggct
tgcatgctgggccagtga

DBGET integrated database retrieval system