KEGG   Mus musculus (mouse): 104009
Entry
104009            CDS       T01002                                 

Gene name
Qsox1, 1300003H02Rik, QS, QSOX, Qsc, Qscn6, SOx, b2b2673C, b2b2673Clo
Definition
(RefSeq) quiescin Q6 sulfhydryl oxidase 1
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104009 (Qsox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     104009 (Qsox1)
Motif
Pfam: QSOX_Trx1 FAD_SOX Evr1_Alr Thioredoxin Thioredoxin_8 Thioredoxin_2 DUF35_N
Other DBs
NCBI-GeneID: 104009
NCBI-ProteinID: NP_001020116
MGI: 1330818
Ensembl: ENSMUSG00000033684
Vega: OTTMUSG00000025411
UniProt: Q8BND5
Structure
PDB: 

Position
1; 1 G3
AA seq 748 aa
MRRCGRLSGPPSLLLLLLLLSPLLFSGPGAYAARLSVLYSSSDPLTLLDADSVRPTVLGS
SSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCAEETNSAVCREFNIAG
FPTVRFFQAFTKNGSGATLPGAGANVQTLRMRLIDALESHRDTWPPACPPLEPAKLNDID
GFFTRNKADYLALVFEREDSYLGREVTLDLSQYHAVAVRRVLNTESDLVNKFGVTDFPSC
YLLLRNGSVSRVPVLVESRSFYTSYLRGLPGLTRDAPPTTATPVTADKIAPTVWKFADRS
KIYMADLESALHYILRVEVGKFSVLEGQRLVALKKFVAVLAKYFPGQPLVQNFLHSINDW
LQKQQKKRIPYSFFKAALDSRKEDAVLTEKVNWVGCQGSEPHFRGFPCSLWVLFHFLTVQ
ANRYSEAHPQEPADGQEVLQAMRSYVQFFFGCRDCADHFEQMAAASMHQVRSPSNAILWL
WTSHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNGQVPLWDLGATLNFLKAHFS
PANIVIDSSASRHTGRRGSPEATPELVMDTLKLESRNSVLGHEQAASAESPGATALDVPA
EKPEASGPQELYTGLRMGGASPGQGPPERMEDHQRDMQENAPGQQHLSKRDTEALFLPEV
NHLQGPLELRRGGRSPKQLAPILEEEPEALAIQGQGQWLQVLGGGISHLDISLCVGLYSV
SFMGLLAMYTYFRARLRTPKGHASYPTA
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgaggaggtgcggccgcctctcggggccgccatcgctgctgctactactgctgctgctc
tcgcctctgctcttctcggggcccggcgcttacgcggcccggctctcagtgctctactcg
tcctctgacccgctgacgctgctggatgctgattcggtgcgtcccactgtgctcggctcc
agcagcgcctgggcggtggagttcttcgcctcctggtgtggccactgcatcgccttcgcc
ccgacgtggaaggagcttgctaacgacgtgaaagactggaggccagcactcaatcttgct
gtcctggactgtgctgaggagaccaacagtgctgtctgcagagagttcaacatcgctggc
ttcccgactgtgaggttttttcaggcctttaccaagaacggttctggagcgacactgcca
ggtgctggcgctaatgtgcagactctgcgtatgaggctcatcgatgctctggagtcccac
cgtgacacatggcccccagcctgtccacctctggaacctgccaagctgaatgatatcgac
ggattctttacaagaaataaagcagattacctggccctggtctttgaaagggaagactcc
tacctgggtagagaggtaactctggacctgtcccagtaccatgctgtggcagtgcgcagg
gtcttgaatacagagagtgacctggtgaacaagtttggcgtcactgacttcccatcttgt
tacctgctgcttcggaatggctctgtctcccgagtgcctgtgctggtggagtccaggtct
ttctatacatcctatcttcgggggctacctggactgaccagggatgctcccccaaccaca
gccaccccagtcactgctgataagatagcacccacagtgtggaagtttgcagaccgctcc
aagatctacatggccgacctggagtccgcactccactacatcttgcgtgtagaagtgggg
aagttctcagtgctggagggacagcgcctggtggccctgaaaaagtttgtggcagtattg
gccaagtacttccctgggcagcctttggtccagaacttcttgcattccataaacgactgg
cttcagaagcagcagaagaagaggatcccctacagtttcttcaaagctgctctggacagc
aggaaggaggatgctgtccttactgagaaggtgaactgggtcggctgccagggcagtgag
ccacacttccgggggtttccctgctcactgtgggtcctcttccacttcctgacggtgcag
gcaaaccgatatagtgaggcccacccacaggaaccagctgatggccaggaggtcctccaa
gccatgaggagctatgttcagttcttctttggctgtcgtgactgtgcggaccattttgag
cagatggctgcagcgtccatgcaccaagtgagaagtcccagtaatgcgattctttggctc
tggactagccacaacagggttaacgctcgcctctcaggtgctctgagtgaggacccccac
ttccccaaggtgcagtggcctccccgtgagctgtgttctgcctgccataatgaactcaac
ggacaggtgcctttgtgggaccttggtgccaccctcaactttctcaaggctcacttctcc
ccagcaaacatcgtcatagactcttctgcatctagacacacaggccggagagggagtcca
gaagctacccccgagctggtaatggatacattaaaactggagagcagaaattcagtgttg
ggccatgagcaggctgcttctgcagagtcccctggagccactgccctagatgtaccagct
gagaagcctgaagcaagtggcccccaagaactatacacaggcctcagaatgggtggagct
tcaccagggcagggccctcctgagcgcatggaagaccaccagagggatatgcaggagaat
gcccccgggcagcaacacttgagcaagagagacactgaagccttatttctgcctgaggtg
aaccacctccaaggccctttagagctcaggcgagggggccgcagccccaagcaactagcc
cccatacttgaagaggaaccagaggccctagctatacagggccaaggccagtggctgcag
gttctaggagggggcatttcccacctggacattagcctctgtgtggggctctactccgtg
tccttcatgggcttactggccatgtacacctactttcgggccaggctgagaaccccaaag
ggccatgctagttaccccacagcctga

DBGET integrated database retrieval system